KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_p0023Help
Entry
HDEF_p0023        CDS       T00911                                 

Gene name
traY
Definition
(GenBank) TraY conjugal transfer protein
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Prominin
Motif
Other DBs
NCBI-ProteinID: ACQ68900
UniProt: C3M8C9
Position
pHD5AT:complement(25287..27434)
Genome map
AA seq 715 aa AA seqDB search
MKKGLRLVSVFSLIVCSPQIFAEEVNFQHLSDAAKRSGDLSRQMLVMIFGDIVNNPLHPT
HTTMIGELFFVFNSLIATIALFWFITVTLRQMVQAGHQGQVFRSGRSPLYPVTVLLGFLS
LVPTSSGWSLSQLIVLWAASIMGVGSANLITDKAATLLQGGHSLVMQPIAPQTLTASRAI
FEMNLCMYGINEELHRMYSESGPAKGTPYMRIKTLPEGFIISNGSAQCGSARLPVTPKNT
HWTPLFSVPVNTAPLVLAQNQSLNRMQNQLSKAAYEFVQQFKKKLDTGTGKIEDVESQIQ
KAAREYEDHIRQEVRAMNHETQLQDVVAAQLRQYGWLALGSWYQTFATANNKTNAVVNMR
PTVTGMSKLGEIGVGSYHEKLTVAYRAQIQNSTYTAPLGTQSSKDSQKVSEASDASSLLI
GLTSSWGQATIRQIVNTNFDSKNDSNNQMNPLLKMKAIGDYTLGGATSIFGAYTGAKLFT
AWGKGNLAGNVINIITGAGDVADSLLQAIGPIVYFLVFILLSIGFSLSVYLPFIPFIYWI
SAATNWIVGVLIGATAGSLWAATHLGGEEDRGSRSAYGYVFLIDVMLRPMLMVFGFLFAS
LVVVAVGTLLNTLFASALANVQADSITGLISIVGVLMIYARICTTLVSSAFSLQVSMPDY
VISWLGGREGASMLGGMNESIKGMFANFGSGAKTAPSPKKLVPKPTAHDQEDGIK
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagggactccgtctcgtcagtgtcttttcactgatagtttgttccccgcaaatt
tttgccgaagaggtcaattttcaacacttatctgacgcagcaaagcgcagtggcgattta
tcccggcaaatgttagtgatgatttttggggatatcgtgaataaccccttacatccgaca
cacaccacgatgattggggaacttttttttgtctttaacagcctgattgccaccattgcc
ctcttttggtttattaccgtcactttgcgtcaaatggtgcaagccggtcatcaaggtcaa
gtcttcagaagcggcagaagccctctttatcctgtgactgtcttgctcggttttctcagt
ctggtgccgacttcttcaggctggtcactctcacagctgattgtgctctgggccgcttcc
atcatgggggtgggttcggctaatctcatcaccgataaagcggcgactttgcttcaagga
gggcattccctggtgatgcaacccattgcgccgcaaacgctcaccgcttctcgggccatc
tttgaaatgaacctgtgtatgtatggcatcaatgaggaacttcacaggatgtacagtgaa
agcggcccagcaaaagggacgccttatatgcgcatcaaaacccttccagaaggctttatc
atcagcaatggcagcgcgcaatgtggctcggcccgcctccctgtgaccccaaaaaatacg
cactggacaccgctttttagcgtgcccgtgaacaccgcgccgttagtcctggcacaaaat
caatcgcttaatcgcatgcaaaatcagctttcaaaagcggcttatgagtttgtgcagcaa
tttaagaaaaaactcgacaccggcacagggaaaatagaggatgtggaaagtcaaatccag
aaagcggcccgagaatatgaggaccacatcagacaggaagtccgcgcaatgaatcatgaa
acccaattacaggatgtggtcgccgctcagctcagacagtacggttggctggcattggga
agctggtatcaaacctttgccaccgcgaataataaaaccaacgccgtcgtcaatatgcgt
cctactgtgacaggaatgtcgaaattaggtgagataggcgtaggctcttatcacgaaaaa
ttgacggtcgcttaccgggctcaaattcagaacagtacttatacagcgccattaggcaca
cagagtagtaaagatagtcagaaagtcagtgaggcttcagatgcctcgtctttattaata
ggtttaacaagctcttgggggcaagctacgataagacaaatagtgaacacaaatttcgat
tcaaaaaatgattcaaacaatcaaatgaatccacttttaaaaatgaaggcgattggggat
tatacgttaggcggtgctacatccatatttggtgcctatactggtgctaaattattcacc
gcttggggtaaaggtaatttggcaggcaatgtgattaatatcattacaggggctggagat
gtggcggatagcttgcttcaagcgataggacccatcgtctattttttggtgttcatactg
ttaagtatcggttttagtttatcagtctatttaccgtttattccctttatttactggatc
agtgccgccactaactggattgtgggcgtactgattggcgcaacggcaggctcattatgg
gctgctacccatttaggaggtgaggaagacagaggaagccgctccgcctatggttatgtg
tttttaattgatgtcatgttgcgccctatgttgatggtctttggcttcctctttgccagt
ctggtcgtggtggcagtaggcacattacttaatactttatttgcttcagcactcgccaat
gtacaagccgattccatcaccggtttaatcagtattgtgggcgttttgatgatttatgcg
cgaatttgcaccacccttgtctccagtgcattcagcttgcaggtcagcatgcccgattac
gtgatttcttggttaggaggtcgtgaaggggccagtatgttgggaggcatgaacgaatcc
attaaggggatgtttgctaactttggcagtggtgcaaaaacagcgccctcaccaaagaaa
ctcgtgcctaaacctactgcccatgatcaagaagatggcattaaataa

DBGET integrated database retrieval system