KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_p0025
Entry
HDEF_p0025        CDS       T00911                                 

Gene name
traW
Definition
(GenBank) TraW conjugal transfer protein
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
SSDB
Motif
Pfam: TetR_C_11
Other DBs
NCBI-ProteinID: ACQ68902
UniProt: C3M8D1
Position
pHD5AT:complement(28077..29270)
AA seq 397 aa
MKKIFLTGTLLLAGHALAMPVEVTHSLPISTQVVPALSAINATLAQIAATEFQIGTAINQ
NSNKLASMLAETAKNQRDQDTFIRKTQRLEAARRSYTVPKSICSESASGMATQVAANATA
TQSHLAKGNGMAHRHIQTAIKTSAEPVEQEQFRAAKIHADYCSAEEYAASGGAPLCQKIS
ELPNGDIELRSVLSGAGKVGSDPALTLTQAQTDAAMMYLKNTAQRSAGDPLKKGELNTAS
GQQYQGLLHQYQAIVSAASHPQRALIAASQASPQTRAVLRETLQTPSAAAYFEQQASPEA
KRTQNLSQREFEFFEVGRRYANTDYLTDLQSMSGDNLIRESIRIQNLQNWLLLGIKQQLQ
EGNILQGQQLGLQAVQEFRPLLHQKRQHISAGVSRNE
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgaaaaaaatattcctgaccggcaccttactcttagctggccatgccttggccatgccg
gtcgaagtgacgcacagtctccccatcagcacccaagtggtccctgcgctctcagccatc
aatgccacgttagcgcaaatcgccgccaccgaatttcagattggcaccgccatcaatcaa
aacagcaataaattggcttccatgctggcagaaacggccaaaaatcagcgggatcaggac
acctttattcgaaaaacgcagcggctcgaagccgcccgtcgcagttataccgtccccaag
agtatttgcagtgaatcggcctcagggatggccactcaagtcgctgcaaacgcgacggcc
acacaaagccatctggcgaaaggaaacgggatggctcatcgacatattcaaacggccatc
aaaacctcagcagagcctgtagagcaggaacagtttcgcgccgccaaaatccatgccgac
tattgcagtgcagaagaatatgccgcttccggcggtgcgcctctatgtcaaaaaatctcc
gagctgcccaatggcgatatcgaattacgctccgtgctctcgggggcgggcaaagtgggc
agcgaccctgccctcaccttgactcaggcacagacggatgcggccatgatgtacctgaaa
aataccgcccagagatcggccggagaccccctcaaaaaaggcgaactcaacacggcttcg
ggtcagcaatatcagggactcctccatcaataccaggccatcgtctctgcggccagccat
ccgcaacgcgccctcattgccgccagtcaggccagtccacagacccgagcggtgttaaga
gaaaccctgcaaaccccttcggcggccgcgtattttgagcaacaggcctcaccggaagcc
aaaagaactcaaaacctctctcaaagagaattcgagttttttgaagtcgggcggcgttac
gccaatacagactacctgaccgacctgcaatcgatgtcaggggataatttgatacgtgaa
tcgatacgcatccagaaccttcaaaactggctgttgctcggcatcaaacaacagcttcag
gagggcaatattctccagggtcagcaactgggccttcaggcagtacaggaatttcggcct
ttattgcaccaaaaacgccaacacatcagcgcaggagtgagtcgaaatgaataa

DBGET integrated database retrieval system