KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_p0030
Entry
HDEF_p0030        CDS       T00911                                 

Gene name
traR
Definition
(GenBank) TraR conjugal transfer protein
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
SSDB
Motif
Pfam: H2TH
Other DBs
NCBI-ProteinID: ACQ68907
UniProt: C3M8D6
Position
pHD5AT:complement(33660..34055)
AA seq 131 aa
MRSFHDKILFFYVHLSLWANRLRQKTGQVLIALLSLCVTQSASADEDIAGMVNHITQGIA
SVQSGLMKAAQVAGVGCVLAGIFLWLRKKXDPHIKGSSIAILIGIGCILIALDQFISRGQ
KQAGLRPVNLS
NT seq 396 nt   +upstreamnt  +downstreamnt
atgcgttcatttcacgacaaaattttgtttttttacgtccatctgtctctctgggctaat
cgcctgcgccaaaaaacagggcaagtcctgatagccctgctcagcctgtgtgtgacccag
agcgcctctgctgatgaggacattgcggggatggtcaaccatatcacacaagggatcgcc
agcgttcaatcagggctgatgaaggcggcgcaagtggccggcgtcgggtgcgtgctggcg
gggatttttttgtggttacgtaaaaaaantgacccccatatcaaagggtccagtattgcg
atattgattggcattggctgcattttaatcgccctcgatcaattcatcagtcgaggacaa
aagcaggccggactcagaccggtcaacctgagctga

DBGET integrated database retrieval system