KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_p0031
Entry
HDEF_p0031        CDS       T00911                                 

Gene name
traQ
Definition
(GenBank) TraQ conjugal transfer protein
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
SSDB
Motif
Pfam: Ycf66_N
Other DBs
NCBI-ProteinID: ACQ68908
UniProt: C3M8D7
Position
pHD5AT:complement(34103..34642)
AA seq 179 aa
MNTDLIQMLGHLANTLTKSGINLVMSLSVVMGIFSATVYCVRLARPKTHRQGGGFSLGKG
VLFLMMCGGLISLRQIMNASSHQLGFGDVTFDAIAYVSPSRYGPAAEALNAVLTLLRLLG
VIFFYQGIRRMKRSLIDGHTGLSAGEDVSHGVVKVLIGTLLICNPYFLTALKNTLNIVW
NT seq 540 nt   +upstreamnt  +downstreamnt
atgaataccgaccttatccaaatgttgggtcatttggccaacacgctcacgaaatcgggg
atcaacctggtcatgagtctctctgtggtgatggggatcttcagtgcgacggtttattgt
gtgcgattggcccgccctaaaacgcatcgacaagggggcggattttccctgggaaagggg
gtgctgtttttgatgatgtgtggaggactcatctcattaaggcaaatcatgaatgcctct
tcgcatcaactgggatttggtgatgtcacctttgatgccattgcttatgtctccccctct
cggtatggccccgcggcagaagccctcaatgccgttctcactctgttgcgtctgttaggg
gtcatttttttctaccagggcatccggcgcatgaaacgatcgttaatcgacggccatacc
ggcctcagcgcaggagaagatgtctctcatggcgtggtcaaagtactgataggcaccctg
ctgatctgcaatccttattttctcaccgcactcaaaaataccctcaatatcgtctggtaa

DBGET integrated database retrieval system