KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_p0033
Entry
HDEF_p0033        CDS       T00911                                 

Gene name
traO
Definition
(GenBank) TraO conjugal transfer protein
  KO
K12209  intracellular multiplication protein IcmE
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Brite
KEGG Orthology (KO) [BR:hde00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hde02044]
    HDEF_p0033 (traO)
Secretion system [BR:hde02044]
 Type IV secretion system
  Icm/Dot secretion system protein
   HDEF_p0033 (traO)
SSDB
Motif
Pfam: TrbI Chordopox_A13L AIM3 PSK_trans_fac
Other DBs
NCBI-ProteinID: ACQ68910
UniProt: C3M8D9
Position
pHD5AT:complement(35434..36606)
AA seq 390 aa
MKIEQELAREAGKSLILLMICIVVLAVLIYLILQWTDTPIETKSIVQIDSVASQTGRPTK
ESAEYRALLEKYNRTESEKAREEGQSFVARIREGTEENQKPSPASLPDENRYAPPPVTEQ
EKGSAFTETGANEHRRKAIDTLLQELNAQWQPVAFQLAPLIEGGEAVSEGTWTDSVAQQS
TAPLPLTGNDITEKAIVAPYTRVPAVIETAVDSDNPDSQVLAKIPTGAYAGAQLQAKRVQ
LVGDGLSIHFERMSWRGQTYAVEAYALDEKTLQSSVASTVNHRYFSRIILPAVAMGMGRA
GQLFEQANTQNTITPQGTVIQTRASNPDGRAIAGTIVGGIGQQAAQVMTHDAARLPIQQV
TLHRGQIIAIQFMGGVYEKDNLRLKSERAK
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgaaaattgaacaagagctcgcgagggaggcggggaaatcattgatattattgatgatc
tgcattgttgttttagctgtgttgatttatttgatcctccaatggacagacacccccatt
gaaacgaaatcgatcgtccagattgacagtgtcgcctcacagacaggccgaccaaccaaa
gaaagcgccgaataccgggcactgttagaaaaatacaacaggactgaatcagaaaaagcc
cgagaggaaggccaaagctttgtggctcgcatcagggaagggacagaagaaaatcaaaaa
ccgtccccggcctctcttccagacgaaaatcggtatgcgccccctcctgtcacggagcag
gaaaaaggaagcgcattcacggaaaccggcgccaatgaacaccgaagaaaagccatcgac
accttgctccaggagttaaatgcgcaatggcaacccgtggcctttcaattggcccctctc
attgaaggaggagaagcggtctctgaaggcacatggacagacagtgtagcccaacaatcg
acggcccctctgcctttgacaggcaatgacatcactgagaaagccattgttgccccctat
acccgtgtgcctgcggtgattgaaacggccgtcgattcggataatcctgattcgcaggta
ctggcaaaaattcccacaggcgcttatgccggggcgcaattacaggcaaaacgcgttcaa
ttagtgggtgacggcctcagcattcactttgagcgcatgagttggcgcggacagacctac
gccgtggaggcctacgccctcgatgaaaaaaccttgcaatcctctgtcgccagtacagtc
aatcatcgttatttttctcgcattattttacctgcggtggcgatgggaatgggtcgcgca
gggcaactgtttgagcaagccaacactcaaaatacgatcacacctcaaggcacggtgata
caaactcgcgcctcgaatcctgatggcagggccattgcaggcacgatcgtcggggggata
ggccaacaggccgctcaggtcatgacccatgatgccgcgcgattacccatccaacaggtc
actcttcaccggggacaaatcatcgccatccagtttatgggcggcgtttatgaaaaagat
aatcttcgtctcaaatcagaaagagcgaaatga

DBGET integrated database retrieval system