KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_p0035Help
Entry
HDEF_p0035        CDS       T00911                                 

Gene name
traM
Definition
(GenBank) TraM conjugal transfer protein
  KO
K12214  intracellular multiplication protein IcmL
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Brite
KEGG Orthology (KO) [BR:hde00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hde02044]
    HDEF_p0035 (traM)
Secretion system [BR:hde02044]
 Type IV secretion system
  Icm/Dot secretion system protein
   HDEF_p0035 (traM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T4BSS_DotI_IcmL
Motif
Other DBs
NCBI-ProteinID: ACQ68912
UniProt: C3M8E1
Position
pHD5AT:complement(37611..38282)
Genome map
AA seq 223 aa AA seqDB search
MKKNSDLGDNKDNAPYKAALELHHQNQLGAQFARTTLTLCLTTSLCLIVSLLLNGYLGWT
VAHPPVKYFATQEGRVIPLIPTHQPVLTVSQVSDFGAHTIREAFTMDFVHFKEQMSRVSA
YFSEEGFKSYYQALTQSNVLAAVRDKKMNLAVMLAPGVVRQKGPLSNGVYAWEIQYPVTL
KLSGQTLSLPEQRFIFSLFLQRADLREKPNGLEVTQLVTFDAK
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaattccgacctgggtgataataaggacaatgctccttacaaagcggctctt
gagctccatcatcaaaatcaactgggggctcaatttgcccgaaccacattaacactctgc
ctgacaaccagcctgtgtctcatcgtgtcgcttctgctcaatggctatttaggctggaca
gtggcgcatccccccgtcaaatactttgcgacacaggaaggacgagtgatcccactcatc
ccaacacatcaaccggtgttgacggtatctcaagtgtcagattttggcgctcacaccatc
cgggaagccttcaccatggattttgtgcattttaaggagcaaatgagccgggtttcagct
tatttttcagaagaaggatttaaaagttattaccaggcgttgacacaatcgaacgtctta
gcggccgttcgagacaaaaaaatgaatctggccgtcatgttagcgcccggcgtcgttcgc
caaaaagggcctttgtccaatggcgtctatgcgtgggaaatccagtatcccgtgacatta
aaactctcaggacagacgctgtctctacccgagcaacgctttattttttctctctttctg
caacgcgccgatctgagagaaaaacccaatggactggaagtgactcaattagtcaccttt
gatgcgaaatga

DBGET integrated database retrieval system