KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_p0039Help
Entry
HDEF_p0039        CDS       T00911                                 

Gene name
traJ
Definition
(GenBank) TraJ conjugal transfer protein
  KO
K12203  defect in organelle trafficking protein DotB [EC:7.2.4.8]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Brite
KEGG Orthology (KO) [BR:hde00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hde02044]
    HDEF_p0039 (traJ)
Secretion system [BR:hde02044]
 Type IV secretion system
  Icm/Dot secretion system protein
   HDEF_p0039 (traJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T2SSE AAA_23 AAA_29 ABC_tran AAA_22 AAA_16 AAA_25 NACHT AAA_33 RNA_helicase Ploopntkinase3 AAA_7 ATP_bind_1 ATPase GTP_EFTU AAA_21 SMC_N
Motif
Other DBs
NCBI-ProteinID: ACQ68916
UniProt: C3M8E5
Position
pHD5AT:complement(41875..43041)
Genome map
AA seq 388 aa AA seqDB search
MTENSLPPFDFSAGLTADTLRRFFAWCASHQVTDIHLQGGAPMMVGRYGRLIKASAFRLE
EAQLTKLIDEIFTPEIKAMVKSGQGVDRALQLEGDANGRYGLPRGERLRFRANFIQATAG
RQELTMAVTLRLIPSQIPTLESLAIEPELFKNLLPHKGLIWVCGETGSGKSTLLAAIYQY
CGRVYPDRKIVTFEDPIEYILGTPENRLPPTQSQIGRDVSSFSEGLRLALRQAPDVIGVG
EIRDGETLMGAIACGQSGHLCLSTLHTHSPAETIPRAVLMFPPDRREAVAHDLLGILQVI
VVQQLLRTTDGQRQAIREYLIFDDAVRQALSELNYTQWSAWINRRLKTQKARLADKAWQL
YQEDRIADEELLTVMSHSEREGRKKNTL
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgacggaaaatagcctgccaccctttgatttcagcgcgggattaacggcagacaccctg
cggcgatttttcgcctggtgtgcgagtcaccaggtcaccgacattcatctccagggcggc
gcgcccatgatggtcggccgttacgggcgattgatcaaagccagtgcctttcgcctggaa
gaggcgcaattaacgaaattaatcgatgaaatctttacgccagaaatcaaggcgatggtg
aaatcagggcagggcgttgatcgggcactccagctcgagggcgatgcgaatggacgctac
ggattaccacgaggagaacgcctgaggtttcgggccaattttattcaagccacggcggga
cgtcaggaattaaccatggcggtgacattaaggctcattccttcccaaatcccgacactc
gagagtttggccatcgagcctgagttattcaaaaacctgttgccccataagggattaatc
tgggtgtgtggcgaaaccggctcggggaaatcaacgttactggcggccatttatcaatat
tgtgggcgggtgtatcccgatagaaaaatcgtcaccttcgaagatcccattgaatatatt
ctcggcacgccagaaaatcgtttgcctccgacccaatcccaaattgggcgtgacgtgagc
agcttttcggaaggactgagactggcgctacgccaggcgcctgatgtcattggggtggga
gaaattcgagatggggagaccttgatgggggccattgcctgcggtcagtcagggcatctg
tgtttgtctaccttgcacacccattctcccgctgaaaccattccccgagcggtcttgatg
tttcccccagacaggcgggaagccgtcgcgcacgatttgctgggaatattacaggtcatt
gtcgtgcagcagttattacgcaccacagacggccaacgccaggccattcgtgaatatctc
atttttgatgacgccgtgcgacaagcgctctctgagttgaattacacccaatggagcgca
tggattaaccgacgtttaaaaacgcaaaaagcccgtttggctgataaagcatggcaatta
tatcaggaagaccggattgctgacgaagagctcctcaccgtcatgagccacagcgaaagg
gaaggaagaaagaaaaataccctctga

DBGET integrated database retrieval system