KEGG   Hartmannibacter diazotrophicus: HDIA_2386Help
Entry
HDIA_2386         CDS       T05217                                 

Gene name
cysS
Definition
(GenBank) Cysteine-tRNA ligase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
hdi  Hartmannibacter diazotrophicus
Pathway
hdi00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:hdi00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    HDIA_2386 (cysS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hdi01007]
    HDIA_2386 (cysS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hdi03016]
    HDIA_2386 (cysS)
Enzymes [BR:hdi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     HDIA_2386 (cysS)
Amino acid related enzymes [BR:hdi01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   HDIA_2386 (cysS)
Transfer RNA biogenesis [BR:hdi03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    HDIA_2386 (cysS)
 Prokaryotic Type
    HDIA_2386 (cysS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g tRNA-synt_1f tRNA-synt_1 DALR_2
Motif
Other DBs
NCBI-ProteinID: SON55927
UniProt: A0A2C9D6J1
Position
1:2541439..2542875
Genome map
AA seq 478 aa AA seqDB search
MTVTLRLYNTLTRTKDDFVPIDPANVRMYVCGPTVYDYAHIGNARPVIVFDLLFRLLRHV
YGEAHVSYVRNITDVDDKINARAASEHPGLPLNEAIRKVTSVTETQFMADIAELGCLTPT
AQPRATEHIADMIALIERLVEKGVAYVAENHVLFSPSAMNARPGPRYGTLARRSLDEMLA
GARVDVAPYKRDPMDFVLWKPSKEGEPGWPSPAGIEGLGRPGWHIECSAMSMAKLLAPDG
GGLSCDDPKKNIFDIHGGGIDLVFPHHENEIAQSCCALGTGVMANVWMHNGFLQVEGEKM
SKSLGNFFTIRELLDDWPGEVLRFNMLRTHYRQPIDFTIKGLEESWKLLDDWYQSVGDIA
GTTPAAGVLEALADDLNTPKAIAELHGLKSDNAALAGSLRFMGFLTESPEAFAARRPTAD
VDEAEIRKLIDERLAARAAKDFAASDRIRDELGEMGVLLKDGKDPATGKAVTTWELKR
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgactgttacgctgaggctctacaacacgctgacgcgcacgaaggacgacttcgtgccg
atcgatccggccaacgtgcgcatgtatgtctgcgggccgacggtctacgactatgcccat
atcggcaacgcccgcccggtaatcgtcttcgacctgctgttccgcctgctgcgtcatgtc
tatggtgaggcacatgtctcctacgtgcgcaacatcacggacgtcgacgacaagatcaac
gcgcgcgcggcgagcgagcatcccggcctgccgctcaacgaggcgatccgcaaggtgacc
tcggtgaccgagacccagttcatggcggacatcgccgaactcggttgcctgacgccgacg
gcgcagccgcgcgccacagagcacatcgccgacatgatcgcgctcatcgagcgtctggtc
gaaaagggcgtcgcctatgtcgccgagaaccacgtgctcttctcgccgtcggccatgaac
gccagacccggtccgcgctacggcacactggcccgccgctcgctcgacgagatgctggcc
ggggcccgcgtcgacgtcgcgccctacaagcgcgacccgatggacttcgttctctggaag
ccctcgaaagagggcgagcccggctggccgtcgccggcgggcatcgaagggctcggtcgt
ccgggctggcacatcgaatgctcggccatgtcgatggccaagctgctagcgccagacggt
ggaggcctttcctgcgacgacccgaagaagaatatcttcgacatccacggcggtggcatc
gatcttgtcttcccgcaccacgagaacgagatcgcccagagctgctgcgcgctcggcacc
ggcgtcatggcgaatgtctggatgcacaacggcttcctgcaggtggagggagagaagatg
tcgaagtcgctcggcaacttcttcacgatccgcgaactgctcgacgactggccgggcgag
gtgctgcgcttcaacatgctgcgcacgcactaccgccagcccatcgacttcaccatcaag
gggctggaggagagctggaagctgctcgacgactggtaccagtcggtcggagacatcgct
ggcacaacgccggccgctggcgttctggaggcgctggccgatgatctcaacacgccgaag
gccattgccgaactccatggcctgaagtcggataatgcggcgctcgccggttcgctgcgc
ttcatgggcttcctgaccgagagcccggaagcatttgccgctcgccggccaaccgccgat
gtcgacgaggccgagatccggaagctgatcgacgagcgcctcgctgcccgtgccgcgaag
gacttcgccgcctcggaccgcattcgcgacgagctcggcgaaatgggtgtattgctcaag
gacggcaaggacccggcgacgggcaaggccgtcaccacatgggaactgaagcggtga

DBGET integrated database retrieval system