KEGG   Hartmannibacter diazotrophicus: HDIA_4118Help
Entry
HDIA_4118         CDS       T05217                                 

Gene name
ywrD_2
Definition
(GenBank) putative gamma-glutamyltransferase YwrD
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
hdi  Hartmannibacter diazotrophicus
Pathway
hdi00430  Taurine and hypotaurine metabolism
hdi00460  Cyanoamino acid metabolism
hdi00480  Glutathione metabolism
hdi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hdi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    HDIA_4118 (ywrD_2)
   00460 Cyanoamino acid metabolism
    HDIA_4118 (ywrD_2)
   00480 Glutathione metabolism
    HDIA_4118 (ywrD_2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hdi01002]
    HDIA_4118 (ywrD_2)
Enzymes [BR:hdi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     HDIA_4118 (ywrD_2)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     HDIA_4118 (ywrD_2)
Peptidases and inhibitors [BR:hdi01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   HDIA_4118 (ywrD_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: SON57659
UniProt: A0A2C9DBV8
Position
1:4465881..4467476
Genome map
AA seq 531 aa AA seqDB search
MVEVHGVSKNGVLVAPHAAAAEAGAEVLRAGGSAVEAMVAAAATIAVVYPHMNGIGGDGF
WIIAEPGRPPVAIEGCGPAGAKATIAAYNEAGHDQVPSRGPLAALTVPGTVGGWKLALEL
AEPLGSGMPLRDLLAQAAAAAKDGITVSRSQAALTAEKLDELKPQPGFADVFLVDGKAPD
EDARLTQPKLADTLDHLGRAGLGDFYRGDVGATLARDLDRMGSPVTEVDIRGFEARRSRP
LSVKIKGATLFNTPPPTQGLAALLILAIFDRLGVERGEGFDHVHGIVEATKRAFLIRNAV
VTDPRLEAPDVAPFLSEASIRREVAAIDMKRAAPWPDPSEPGDTIWMGAIDRNGVAVSFI
QSVFWEFGSGAVSPGTGVLLQNRGSSFSLRPGALNALRPGRRPFHTLNPALARFDDGRVL
SYGSMGGDGQPQFQAQLFTRMVQFGVDMAEAVALPRWLLGKTWGSDSSSLKVEHHFDTSV
VEQLSRAGHFIEVVPAAGSDNFGHAGAVRWRPGGDIEGVHDPRADGGAGRG
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggtggaagttcatggcgtctcgaaaaacggcgttctcgtcgccccgcatgcggcagcc
gcggaggcgggagccgaagtgctgcgggcgggcggcagcgcggtggaggcaatggttgcc
gcagccgcgacgatcgccgtcgtctatccgcatatgaacggcatcggtggcgacggcttc
tggatcatcgccgagcccggacgtccgccggtcgccatcgaaggctgcggccccgccggg
gcgaaggccacgatcgccgcctacaacgaggccggccacgatcaggtgccctcgcgcggg
ccgctcgccgcactcacggtcccgggaaccgttggcggctggaaactggcccttgaactc
gccgagcctctcggcagcgggatgccgctgagagacctcctggcccaagccgctgccgcg
gccaaggacggcatcaccgtgtcgcggtcgcaggcggcgctgacggcggagaagctcgac
gaactgaaaccccagccgggtttcgccgacgtctttcttgtcgacggcaaggcaccggac
gaggacgcgcgcctcacccagccgaaactggccgacacgctcgaccacctgggccgcgcc
ggccttggcgacttctatcgcggcgatgtcggtgccacgcttgcccgcgatctcgaccgg
atgggaagccccgtcaccgaagtcgatatccggggctttgaggcccgccgcagccgccct
ctctcggtcaagatcaagggcgcgacgctgttcaacacgccgccgccgacgcagggcctc
gccgccctcctgatcctggcgatcttcgaccggcttggcgtggaacgcggcgaaggcttc
gaccacgtccatgggatcgtcgaggcgaccaagcgcgccttcctgatccgcaatgcggtc
gtcaccgacccgaggctggaggcacccgatgtcgcccccttcctgagcgaggcctcgatc
cggcgcgaagtggcggccatcgacatgaagcgtgccgcgccctggcccgacccgtccgag
cccggcgacaccatctggatgggcgccatcgatcgcaacggcgtcgccgtttccttcatc
cagtccgtcttctgggaattcggctccggtgccgtctcgcccggaaccggcgtccttctg
cagaaccggggctccagcttctcgctgcggccgggcgcgctcaacgcgctccggcccggc
cggcggcccttccacaccctcaatccggcccttgcccgcttcgatgacggccgcgtcctt
tcctatggctccatgggcggcgacggccagccccagttccaggcccagctcttcacgcgc
atggtgcagttcggggtcgacatggccgaggccgtggctcttccgcgctggctcctcggc
aagacatggggttcggattcttcatcattgaaggtggaacatcattttgacaccagcgtt
gttgaacaattgagccgtgctggccatttcattgaggtggtcccagctgccggttcggac
aacttcggtcatgccggtgccgtcaggtggcgtcccggaggcgatatcgagggcgtccac
gatccgcgtgccgatggtggcgccggaagaggttga

DBGET integrated database retrieval system