KEGG   Halobacterium sp. DL1: HALDL1_02195Help
Entry
HALDL1_02195      CDS       T03878                                 

Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
hdl  Halobacterium sp. DL1
Pathway
hdl00564  Glycerophospholipid metabolism
hdl01100  Metabolic pathways
hdl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hdl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    HALDL1_02195
Enzymes [BR:hdl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     HALDL1_02195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase DUF4131
Motif
Other DBs
NCBI-ProteinID: AHG02568
UniProt: W0K031
Position
complement(131009..131635)
Genome map
AA seq 208 aa AA seqDB search
MFARGSWMWVYALPSAVVGLALLAASSLWGVLALAVSGFVVWFHRDPERTPPHEGVVSPA
DGKVSVIREEDGRVRVGVFMNVTDVHVNRAPLDGTVESVTHRAGGHRPAFDKDSDRNERV
RVDCGEFEVVLIAGAFARRIHPYVEAGDELARGDRIGHVSFGSRADVLLPREYDREDLVV
EEGDTVQAGETVLATHTGRPIERPPLVE
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgttcgctcgcggttcctggatgtgggtgtacgcgctcccgtcggcagtcgtcggcctc
gcgctcctcgccgcgtcgtcgctgtggggcgtgctcgcgctggccgtctccgggttcgtg
gtctggttccaccgcgacccggagcgcacgccgccacacgagggcgtcgtctcgccagcc
gatgggaaggtgtccgtgattcgcgaagaggacggccgcgtccgcgtcggcgtgttcatg
aacgtcaccgacgtgcacgtgaaccgcgcgcccctcgacggcaccgtcgagagcgtcacg
caccgcgcgggcggccaccgcccggccttcgacaaggactccgaccgcaacgagcgcgtc
cgcgtcgactgcggcgagttcgaggtggtgctcatcgcgggcgcgttcgcccgccgcatc
cacccctacgtcgaggccggcgacgaactcgctcgcggcgaccgcatcggccacgtctcc
ttcggcagtcgcgcggacgtcctcctcccacgggagtacgaccgcgaagacctcgtggtc
gaggagggcgacacggtgcaggccggagagacggtgctggccacccacaccggccgcccc
atcgagcggcccccactcgtcgagtga

DBGET integrated database retrieval system