KEGG   Halobacterium sp. DL1: HALDL1_05575Help
Entry
HALDL1_05575      CDS       T03878                                 

Definition
(GenBank) glycosyl transferase family 2
  KO
K13693  glucosyl-3-phosphoglycerate synthase [EC:2.4.1.266]
Organism
hdl  Halobacterium sp. DL1
Brite
KEGG Orthology (KO) [BR:hdl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hdl01003]
    HALDL1_05575
Enzymes [BR:hdl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.266  glucosyl-3-phosphoglycerate synthase
     HALDL1_05575
Glycosyltransferases [BR:hdl01003]
 Others
  Glycosylglycerate
   HALDL1_05575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AHG03116
UniProt: W0JWW2
Position
803659..804744
Genome map
AA seq 361 aa AA seqDB search
MDYTQERVATLHDYGGANPAAPTDRAAVVVPMTDREYAGLAPERVFSELETVDPAEVVVP
LRAPAERVPEFRAWLDGFDVDLTVLWCDGPRVESLLAEADLDGARGKGRDVWLALGVAAD
NDYVVVHDADTTTYEARDVRKLLFPLSAGFEFSKGYYARVENDRLYGRLFRLFYEPLVAA
LDDAHDHEVLSFLGAFRYALAGECAMTGDVARGLRVQRKWGLEVGTLGEAFRLAGTEGAA
QVDLGRYEHDHRAVSGPTGLSEMSEGVGSALFRALEDAGVDVEYDTLPERYLDHAERFVR
AYGADAAFNDLDYDAADERQQTETYAGAIDAPGPDTRLPAWEDAPLDPDEVAAAAAADAE
D
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggactacacgcaggagcgcgtggcgacgctccacgactacgggggtgccaacccggcc
gcgccgacggaccgcgccgccgtggtggtgccgatgacggaccgggagtacgccggtctc
gcccccgagcgcgtcttctcggagctggagaccgtcgaccccgcggaggtcgtggtgccg
ctgcgcgcgcccgccgagcgcgtccccgagttccgggcgtggctcgacggattcgacgtc
gacctcaccgtgctctggtgtgacggcccgcgcgtcgaatcgctgctcgcggaggcggac
ctcgacggcgcgcgcgggaagggccgggacgtctggctggcgctcggcgtcgccgccgac
aacgactacgtggtcgtccacgacgcagacacgacgacgtacgaggcccgcgacgtccgc
aaactcctgttcccgctctcggcgggcttcgagttctcgaagggctactacgcccgcgtg
gagaacgaccggctgtacggccggctgttccgcctgttctacgagccactcgtggccgcc
ctggacgacgcccacgaccacgaggtgctgtcgttcctcggcgcgttccgctacgcgctc
gccggggagtgcgcgatgaccggcgacgtcgcccgcgggctccgcgtgcagcgcaagtgg
ggtctcgaggtcgggacgctcggtgaggcgttccgcctcgcggggaccgagggcgctgcg
caggtggacctcgggcgctacgagcacgaccaccgcgctgtctccggaccgaccggactc
tcagagatgagcgagggcgtcgggagcgcgctgttccgcgcgctcgaggacgccggcgtg
gacgtcgagtacgacacgctgcccgagcgctacctggaccacgccgaacggttcgtgcgg
gcctacggcgccgacgccgcgttcaacgacctggactacgacgccgcggacgagcgacaa
cagaccgagacgtacgccggggccatcgacgcgcccggtccggatacccgcctgccggcc
tgggaggacgcgcccctcgaccccgacgaggtcgcggcggccgccgcggcggacgcggag
gattga

DBGET integrated database retrieval system