KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_1360Help
Entry
Hden_1360         CDS       T01265                                 

Definition
(GenBank) ROK family protein
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Pathway
hdn00010  Glycolysis / Gluconeogenesis
hdn00520  Amino sugar and nucleotide sugar metabolism
hdn01100  Metabolic pathways
hdn01110  Biosynthesis of secondary metabolites
hdn01120  Microbial metabolism in diverse environments
hdn01130  Biosynthesis of antibiotics
hdn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hdn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hden_1360
   00520 Amino sugar and nucleotide sugar metabolism
    Hden_1360
Enzymes [BR:hdn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Hden_1360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Peptidase_S51 FGGY_N
Motif
Other DBs
NCBI-ProteinID: ADJ23172
UniProt: D8JX36
Position
complement(1405389..1406195)
Genome map
AA seq 268 aa AA seqDB search
MPEIGDKKHVLRQDARSGNPNILSVDIGGTLIKAAVIDQSGALVSEFVTTPTPHPATPDT
IIALIARIAAPLPDFGLISIGFPGVVHRECISTAPNLGTAHWKNFDLEQTLRDTFGAPVR
ILNDAIVYGLGVAKGPGRECVLTFGTGMGCALFSDGTIFCGLELGQHYARDDQNYDQYVG
HAAYLELGLDAWNARAERALQAVHALTNADRIYLGGGNSRRITFALPEWATIVQPSSGVA
GGARLWHADMDRWFAPRQPAMAQARERT
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaaatcggcgacaaaaagcatgtccttcgccaggacgcccgaagcggcaatccc
aacatcttgtcggtcgatatcggtggtacactgatcaaggccgctgtcatcgatcaatcc
ggagcgctcgtttccgagttcgtgacaacgcccacgccgcaccccgcgacgccggatacg
atcatcgcgctcatagcccgcatcgctgcgccgctgccggatttcggattgatttcgatc
ggctttccgggcgtcgtccatcgcgaatgcatttcaacggcgcccaacctcggcaccgct
cactggaagaacttcgaccttgagcagacgctgcgcgacacgttcggtgcaccggtccgg
atattaaacgatgccatcgtctatggcctcggcgtcgcgaaagggccgggccgcgagtgc
gttctgacgttcggcaccggcatgggctgcgcacttttcagcgatggcacgatcttctgc
ggcctggagcttggccagcactacgcacgcgacgatcagaactacgatcaatacgtcggc
cacgctgcctatcttgaactcggcctcgacgcatggaacgcgcgggcggagcgtgccctc
caagccgtgcatgccttgacgaacgcagatcgcatttatctcggaggcggaaactcgcgg
cgcatcacgtttgcgcttccggaatgggcaaccatcgttcaaccgtcatcgggcgtcgcg
ggcggagcgcgcctctggcacgcagacatggatcgctggttcgcgccccgccaaccggcg
atggcgcaagcgcgggaacgcacatga

DBGET integrated database retrieval system