KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_1404Help
Entry
Hden_1404         CDS       T01265                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Pathway
hdn00071  Fatty acid degradation
hdn00072  Synthesis and degradation of ketone bodies
hdn00280  Valine, leucine and isoleucine degradation
hdn00310  Lysine degradation
hdn00362  Benzoate degradation
hdn00380  Tryptophan metabolism
hdn00620  Pyruvate metabolism
hdn00630  Glyoxylate and dicarboxylate metabolism
hdn00640  Propanoate metabolism
hdn00650  Butanoate metabolism
hdn00900  Terpenoid backbone biosynthesis
hdn01100  Metabolic pathways
hdn01110  Biosynthesis of secondary metabolites
hdn01120  Microbial metabolism in diverse environments
hdn01130  Biosynthesis of antibiotics
hdn01200  Carbon metabolism
hdn01212  Fatty acid metabolism
hdn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hdn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Hden_1404
   00630 Glyoxylate and dicarboxylate metabolism
    Hden_1404
   00640 Propanoate metabolism
    Hden_1404
   00650 Butanoate metabolism
    Hden_1404
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Hden_1404
   00072 Synthesis and degradation of ketone bodies
    Hden_1404
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Hden_1404
   00310 Lysine degradation
    Hden_1404
   00380 Tryptophan metabolism
    Hden_1404
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Hden_1404
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Hden_1404
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Hden_1404
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hdn04147]
    Hden_1404
Enzymes [BR:hdn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Hden_1404
Exosome [BR:hdn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Hden_1404
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADJ23216
UniProt: D8JX80
Position
1456521..1457825
Genome map
AA seq 434 aa AA seqDB search
MTRELRRVAVIGGVRIPFCRSNTLYADLSNLEMMAAALNGVVDRFGLKGQHIDEVVGGAV
VTHSRDFNLAREAVLSSKLAPSTPGVTLIQACGTSLQSALMSAGKIATGEIESAIAVGSD
TTSDAPIVFSKKFSKRLVQVGQSKTALDKIRVFKGLSPSELAPQPPAVSEPRTGLSMGQH
CELMAQEWKIPRAAQDELAFESHKKGAAAYDEGYMDDLIVPCAGVYRDNNLRPDISLDKL
ASLKPAFEKSERGTLTAGNSTPMTDGASAVLLASEEWAKAHNLPVLAYLTYGQHIANNFV
GGDGLLMAPTIAVSKLLDRAGLTLQDFDFYEIHEAFAAQVLCTLKAWEDADYCKRVLGKD
APLGSIDRAKLNVKGSSLAFGHPFAATGARIVANLAKLLSTNGGRGLISICTAGGMGVAA
ILEAPKSIEARVAA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgacacgagagcttcggcgcgttgcggtgatcggcggtgtccgtatcccgttctgccgg
tccaacacgctttatgccgatctctcgaatctcgagatgatggcggcggcgctgaacggt
gtcgtcgaccggttcgggctcaagggccagcacatcgacgaagtcgtcggcggcgcggtc
gtcacgcattcgcgcgatttcaatctggcacgcgaagcggtgctgtcgtccaagcttgcg
ccatcgacgccgggggtgacgctgatccaagcgtgtggaacgtcgttgcaatcggcgctg
atgtcggcgggcaagatcgcgaccggcgagatcgaaagcgcgattgcggtcggatcggac
acgacatccgatgcaccgatcgttttctcgaagaagttttcaaagcgcctcgtgcaggtc
gggcagagcaagacggcgctcgataaaattcgcgtctttaaagggctgtcgccgtccgag
cttgcgccgcagccgccggcggtttccgagccgcgcacgggcctttcgatggggcagcat
tgcgagctgatggcgcaggaatggaaaatcccgcgcgccgcgcaggacgagcttgccttc
gagagtcataagaaaggcgcggccgcttacgacgaaggctatatggacgatttgatcgtg
ccgtgcgcgggcgtttatcgcgacaacaaccttcgtccggacatctcgctcgataaactt
gcgtcgctgaagcctgcgttcgagaaatcggagcgcggaactttgacagcaggcaattcg
acgccgatgaccgatggcgcgtcggctgtgcttcttgcgtctgaagagtgggcgaaagcg
cacaatctgccggtgctcgcctacctcacgtacgggcaacatatcgccaacaatttcgtc
ggtggcgacggtctgctgatggcgccgacgatcgcggtgtcgaagttgctcgaccgtgcc
gggctgacgctgcaggacttcgatttctatgaaatccacgaagccttcgcggcccaggtt
ctctgcacactgaaagcctgggaagacgccgattactgcaagagggtgctcggcaaggat
gcgccgctcggttcgatcgatcgcgccaagctcaacgtcaaaggctcttctctcgcgttc
ggtcatccgttcgccgcaaccggtgcgcgcatcgtcgccaatcttgcgaaactgttgtcg
acaaatggcggtcgcggcctgatttcgatctgcacggccggcggcatgggcgtcgctgcg
atcctggaagcgccgaaatccattgaagcccgcgttgcggcctga

DBGET integrated database retrieval system