KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_1659Help
Entry
Hden_1659         CDS       T01265                                 

Definition
(GenBank) HpcH/HpaI aldolase
  KO
K08691  malyl-CoA/(S)-citramalyl-CoA lyase [EC:4.1.3.24 4.1.3.25]
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Pathway
hdn00630  Glyoxylate and dicarboxylate metabolism
hdn00660  C5-Branched dibasic acid metabolism
hdn00680  Methane metabolism
hdn01100  Metabolic pathways
hdn01120  Microbial metabolism in diverse environments
hdn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hdn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Hden_1659
   00660 C5-Branched dibasic acid metabolism
    Hden_1659
  09102 Energy metabolism
   00680 Methane metabolism
    Hden_1659
Enzymes [BR:hdn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.24  malyl-CoA lyase
     Hden_1659
    4.1.3.25  (S)-citramalyl-CoA lyase
     Hden_1659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HpcH_HpaI C-C_Bond_Lyase
Motif
Other DBs
NCBI-ProteinID: ADJ23466
UniProt: D8JYL4
Position
complement(1695144..1696202)
Genome map
AA seq 352 aa AA seqDB search
MASTRTPAKHFAPLAIGAPEPFRTLPVNLERMIHFVPPHNDKIRAKIKDLAAQVDVVLGN
LEDAVPLDQKENARKGFIQMLRDNDFGATGVWTRINCLNSPWVLDDVTEIVSNVGNKLDV
VMLPKVEGPWDIHYLDQLLAQLEAKHGVKKPILIHAILETAEGVNNVEAIAAASPRMHGM
SLGPADLAASRGMKTTRVGGGHPDYGVLADPGKDAAAARTFYQQDLWHYTIGKMVDACQA
YGLKAFYGPFGDFSDLAACEAQFRNAFLQGCLGAWTLHPSQIDIAKRVFSPDPAEVKFAK
RILDAMPDGTGAVMLDGKMQDDATWKQAKVIVDLAKIVASKDPERAALYGAL
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggcctcgacacgcacgcccgctaagcacttcgcccctctcgccatcggcgcgcccgag
ccgttccgcacgctccccgtcaacctcgagcggatgatccatttcgttccgccgcacaac
gacaagatccgggccaagatcaaggatctcgcggcgcaggtcgacgtggtgctcggcaac
ctcgaagacgccgttccgctcgatcagaaagagaatgcgcgcaagggattcatccagatg
ctgcgcgacaacgatttcggcgcaaccggcgtctggacgcgcatcaactgcctgaactcg
ccgtgggtgctcgacgacgtgaccgagatcgtctcgaacgtcggcaacaagctcgacgtc
gtcatgctgccgaaggtcgaaggcccgtgggacatccattatctcgatcagcttctcgcg
cagctcgaagccaagcacggcgtcaagaagccgatcctcatccacgccattctggaaacg
gcggaaggcgtcaataacgtcgaagcgatcgcggccgcttcgccgcgcatgcacggcatg
agccttggaccggctgacctcgcggcgtcgcgcggcatgaagacgacgcgcgtcggcggc
ggccatccggactacggcgtccttgccgatccgggcaaagacgcagccgcggcgcgaacc
ttctaccagcaggatctctggcactacacgatcggcaagatggtcgacgcctgccaggct
tatgggttgaaggcgttctacggcccgttcggcgatttttcggatctcgccgcctgcgag
gctcagttccgcaacgcgttcctgcagggctgcctcggtgcctggacgttgcacccctcg
cagatcgacatcgccaagcgcgtgttctcgcccgatccggccgaagtgaaattcgccaag
cgcattctcgacgcgatgcccgatggcaccggcgccgtcatgctcgacggcaagatgcag
gacgacgccacctggaaacaggcgaaggtcattgtcgatctggcgaagatcgtcgcgtcg
aaagatccggaacgggcggcgctttacggcgcgctctga

DBGET integrated database retrieval system