KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_1729Help
Entry
Hden_1729         CDS       T01265                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Pathway
hdn00450  Selenocompound metabolism
hdn00970  Aminoacyl-tRNA biosynthesis
hdn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hdn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Hden_1729
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Hden_1729
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hdn01007]
    Hden_1729
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hdn03016]
    Hden_1729
Enzymes [BR:hdn01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Hden_1729
Amino acid related enzymes [BR:hdn01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Hden_1729
Transfer RNA biogenesis [BR:hdn03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Hden_1729
 Prokaryotic type
   Other AARSs
    Hden_1729
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1 DUF4031
Motif
Other DBs
NCBI-ProteinID: ADJ23536
UniProt: D8JYT4
Position
complement(1762050..1763612)
Genome map
AA seq 520 aa AA seqDB search
MREKFYITTAISYPNGVPHIGHAYEAIATDVIARFERLDGKDVFFLTGTDEHGLKMKQTA
EREGVTPRELADRNSARFIEMVKTLGLSNDDFIRTTEQRHYDACAELWRRMEKAGDIFKR
PYGGWYSVRDETYYKESETEVREGQRFATATGTPVEWNEEETYFFRLSAYQDKLLAHYEA
NPDFILPAERRNEVVSFVKMGLEDLSISRTTLDWGIPVPDAPGHVMYVWIDALNNYVTAT
GLLTDPQGSRAHYWPANVHVIGKDIVRFHAVYWPAFLMSAGLPLPKRVFSHGFVLNKGEK
MSKSVGNVVDPFDLVKAYGRDALRYFFLREVMFGQDGNYSAEAIANRINADLANNLGNLA
QRSLSMIFKNCDGAIPQPGAFSAEDTAILNATDALYEAARGEMDRQAITKYLDAVWAVVA
EANRYFAAEEPWAKKKADPARMATILYVTAECVRQFAILAQPVMPESAAKLLDLLAVPAE
ARTFASLGSAGRLKAGTAIPEPQGVFPRYVDPEEPKGKKS
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcgaaaaattctacatcacgacggccatttcctaccccaacggcgtgccgcacatt
ggccacgcctacgaggccatcgcaaccgacgtcatcgcacgcttcgaacgcctcgacggc
aaggacgtcttcttcctgacgggcaccgacgagcacggcctcaagatgaagcagacggcc
gagcgcgaaggcgtcacgccgcgcgaactcgccgaccgcaattcggcgcgcttcatcgag
atggtgaagacgctcggcctctcgaacgacgatttcatccgcacgacggaacagcgccac
tacgatgcctgcgccgaactctggcgccgcatggagaaggcgggcgacatcttcaagcgt
ccgtatggcggctggtactcggttcgcgacgaaacctattacaaggagtccgagaccgag
gtccgcgagggccagcgcttcgcgaccgcaaccggaacgcccgtcgagtggaacgaggaa
gaaacctacttcttccgcctgtcggcgtatcaggacaagcttctcgcgcactacgaggcc
aatccggacttcatcctgcccgccgaacggcgcaacgaggtcgtcagcttcgtcaagatg
gggctcgaggatctgtcgatctcgcgcacgacgctcgactggggcatcccggtgcccgac
gcgccggggcacgtgatgtacgtctggatcgacgcgctgaacaactacgtgaccgcgacc
gggctattgaccgatccgcagggctcgcgcgcgcattactggcccgccaacgtacacgtc
atcggcaaggatatcgtgcgctttcacgccgtctattggccagccttcctgatgagcgcg
ggactgcctctgccgaagcgcgtcttcagccacgggttcgtgctgaacaagggagagaaa
atgtcgaagtcggtcggcaacgtcgtcgacccgttcgatctcgtcaaagcctacggccgc
gatgcgttgcgctacttctttctgcgcgaagtgatgttcgggcaggacggcaactattcg
gccgaagcgatcgcgaaccggatcaatgccgatctcgcgaacaatctcggcaatctcgca
cagcgctcgctgtcgatgattttcaagaactgcgacggcgccattccgcagcccggcgca
tttagcgccgaagacaccgcgatcctcaatgcgaccgacgcgctttatgaggccgcgcgg
ggcgagatggatcgtcaggcaatcacgaagtatctcgatgccgtctgggccgtcgtcgcg
gaggccaaccgctacttcgcggccgaagagccgtgggcgaaaaagaaggccgacccggcg
cgcatggcgacgatcctttacgtcacggccgagtgcgtgcgccagttcgccatcctcgcg
caaccggtgatgcccgagagcgcggcaaagctgctcgacctccttgcggttccggcggaa
gcgcgcacatttgcaagtctgggatcggcgggacgcctcaaggccggcactgcgattccg
gagccgcagggcgtgttcccgcgctacgtcgatcccgaggagcccaagggcaagaaatcg
tga

DBGET integrated database retrieval system