KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_2052Help
Entry
Hden_2052         CDS       T01265                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Pathway
hdn00430  Taurine and hypotaurine metabolism
hdn00620  Pyruvate metabolism
hdn00640  Propanoate metabolism
hdn00680  Methane metabolism
hdn01100  Metabolic pathways
hdn01120  Microbial metabolism in diverse environments
hdn01200  Carbon metabolism
Module
hdn_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:hdn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Hden_2052
   00640 Propanoate metabolism
    Hden_2052
  09102 Energy metabolism
   00680 Methane metabolism
    Hden_2052
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Hden_2052
Enzymes [BR:hdn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     Hden_2052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: ADJ23853
UniProt: D8JPW9
Position
complement(2100031..2101218)
Genome map
AA seq 395 aa AA seqDB search
MSEILITFNPGSSTIKLGLYRMAEDGPVRLGRGVIDLRRTPLLLHVVEGPTVADIPLRAE
VTEDLHELIDETLDWLSDHFALQGIAAAGHRVVHGGDAFSGATLITDDTLATIARFVDLA
PLHQPQSLRLIRAIRHLRPDLPQSASFDTAFHRTQSDIVRRFALPREMFDAGIKRYGFHG
LSYKFAASRLRELAPDLAAGRVVAAHLGSGASLCALENGESRDTSMGFSTLDGIPMATRC
GALDPGVVIHLLKQQGQSLASVEDILYHRSGLLGVSGISADSRDLLGSDQPAAREAIALF
THRIAQEIAALATTLGGLDAVVFTAGIGEHQPSIRAAVCARLAWLGVTLDDNANSASATR
IDAQDSKVGVFVIPTDEEQVIATEACALLMSSREA
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaattctgattaccttcaatccgggctcatcgaccatcaagctcggtctttac
cgtatggcggaagacgggcctgtgcgattgggccggggcgtcatcgatctcagacgcacg
ccgctgctgttgcacgtcgtcgaaggtccgaccgttgccgacatcccgttacgcgccgaa
gtcaccgaggatctgcacgaactcatcgatgaaacgctcgactggctgagcgatcacttc
gcacttcagggaatagctgcggccggtcatcgcgtcgtgcacggcggggacgctttctcc
ggtgcaactctgatcaccgatgacacgctggcgacgattgcgcgcttcgtcgatctggcg
ccgctgcatcaaccgcagagtctccggctgatccgcgccatccgtcatctccgccccgac
ctgccgcaatcggcgtcgttcgacacggcgttccataggacgcaatccgacatcgttcgc
cgcttcgccctgcctcgtgaaatgttcgatgccgggatcaagcgatacggatttcacggg
ctgtcctacaaattcgcggcatcgcggctgcgcgagcttgcgcccgatctcgcagccgga
cgtgtcgtcgccgcgcaccttggcagcggcgcgagtctctgcgcgctcgaaaacggcgaa
agccgcgatacgagcatgggcttttcgacgctcgacggaatcccaatggcgacgcgctgc
ggcgcgctcgacccgggcgtcgtcatccatcttctgaagcaacaaggacaatcgctcgcg
agcgtcgaagacattctctatcaccgatcgggattgctcggcgtctcgggaataagcgcc
gacagccgcgatttactcggcagcgatcaaccggcggcacgagaagcgatcgcattgttc
acacatcggatcgcgcaggagatcgccgcgctcgcgacgacgttgggcggcctcgatgcc
gttgtcttcacggcgggcatcggtgaacatcagccttcgatacgcgctgccgtatgtgcg
cgcctcgcgtggctcggcgtcacgctggacgacaatgcaaattccgcgagcgcaacacgc
atcgacgcgcaagacagcaaagtcggcgttttcgtcattccgacggacgaagagcaggtg
atcgccaccgaagcctgcgcgcttctgatgtccagcagagaggcctga

DBGET integrated database retrieval system