KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_2258Help
Entry
Hden_2258         CDS       T01265                                 

Definition
(GenBank) siroheme synthase
  KO
K02302  uroporphyrin-III C-methyltransferase / precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:2.1.1.107 1.3.1.76 4.99.1.4]
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Pathway
hdn00860  Porphyrin and chlorophyll metabolism
hdn01100  Metabolic pathways
hdn01110  Biosynthesis of secondary metabolites
hdn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hdn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Hden_2258
Enzymes [BR:hdn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     Hden_2258
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Hden_2258
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     Hden_2258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 TP_methylase Sirohm_synth_M CysG_dimeriser Amidohydro_2
Motif
Other DBs
NCBI-ProteinID: ADJ24056
UniProt: D8JR71
Position
complement(2313018..2314079)
Genome map
AA seq 353 aa AA seqDB search
MQTSELEDTQKKSARSRPERMQALATLPVFFKLAGKRAVVAGGNEPALWKAELLAATGAH
VEVYAETFVDGFEALASAPPNGSVRLNSRRWTPADLADAAIAIGASEDDEDAAAFAAAAR
AAGAPVNVVDRPAFCDFQFGAIVNRSPLVLSISTDGAAPVLAQAIRSLVEALLPDGLKRW
VEVAKVWRTKGGQLGDTPAAKRKFWNRFVDLAMREAQREPREADFDELARSPGKAPSSVA
IVNVGDDADTLTLRALRVFRMADMIFFDPAVPPAVLDFARREAQRVSVDPGASGATVERI
VDAARNGERVVRLIAVSSASGEASADALSRALHDAGLETPEITFAPSPAKDAT
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgcagacatccgagctagaggacacgcagaaaaaaagcgcgcgatcgcgccccgagcgc
atgcaggcgctcgcgacattgcccgtattcttcaagctcgctgggaagcgcgccgtcgtc
gctggcggcaatgagcccgcgctctggaaagccgagcttttggccgcgacaggcgcccac
gtcgaagtctacgcggaaacctttgtcgatggcttcgaagcgctcgcatcggcgccgccg
aacggttcggtgagactgaattcaaggcgatggacaccagctgatcttgcagatgccgcg
atcgccatcggcgccagcgaggacgatgaagacgccgctgcgttcgccgccgcggcgcgt
gcagctggcgcacccgtcaacgtcgtcgaccgtccggcattctgcgactttcagtttggc
gcgatcgtcaatcgctcgccgctggttctttcgatttcgaccgacggcgccgcgccggtc
ttggctcaggcgatcaggtcgcttgtcgaagcgctgttgcccgatggtttgaagcgctgg
gtcgaggtggcgaaggtttggcgcacgaaaggcggccagctcggcgacacgcccgcagca
aagcgcaagttctggaaccgctttgtcgatctcgccatgcgtgaggcgcagcgcgaaccg
cgcgaggccgacttcgacgagcttgcacgttcacccggtaaagcgccgtcctccgtcgcg
atcgtcaacgtcggcgacgacgccgatacgctgacactccgcgccctgcgcgtctttcgc
atggccgacatgattttctttgacccggcggttccgcccgccgttctcgattttgcacgc
cgtgaagcgcagcgggtctccgttgatcccggcgcaagcggtgcgacggtcgagaggatc
gttgacgcagcaagaaacggcgaacgcgtcgttcgcctcattgccgtgtcgtcggcgagc
ggcgaggcgtctgccgacgcgctgtcgcgcgctttgcatgacgcaggattggagacaccg
gaaatcaccttcgcaccctctcccgccaaggatgcgacctga

DBGET integrated database retrieval system