KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_2519Help
Entry
Hden_2519         CDS       T01265                                 

Definition
(GenBank) class II aldolase/adducin family protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Pathway
hdn00051  Fructose and mannose metabolism
hdn01100  Metabolic pathways
hdn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hdn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Hden_2519
Enzymes [BR:hdn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Hden_2519
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: ADJ24315
UniProt: D8JSM1
Position
complement(2573522..2574196)
Genome map
AA seq 224 aa AA seqDB search
MSKGKSRRPSEKSLRKAVLDTALAMSSSGLSPGRSGNVSCRFDDGMLITPSGVRYDDIDP
DDIVFVSADGSVPDDRQTPSTEWHFHLAAYRARPDRFAVVHTHSMHATVLACAHRAIPAF
HYMVGVAGGKDIPCVPYATFGTAELARHVATGLQDRDACLMANHGQIAIGPTLGHALELA
AEVEALAEQYYKVLTLGPANILNDDEMALLLDKFKTYGRNVAEK
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaggcaagtccaggcgtccgagtgaaaaaagcctgaggaaggctgtgctcgac
acggcgctcgcgatgagctcttccggcctttcgccaggacgatccggaaacgtatcctgc
cgcttcgacgacggcatgctgatcacaccatccggcgtgcgttatgacgacatagatccc
gacgacatcgttttcgtttcagccgacggcagcgttcccgacgatcgccagacgccgtcg
accgaatggcattttcatctggccgcctatcgcgcgcgtcccgatcgcttcgccgtcgtc
cacacgcactcgatgcacgcgacggttctcgcctgcgcgcaccgcgcgatcccggcattt
cactacatggtcggcgtcgcgggcgggaaggacatcccgtgcgtgccttacgccaccttc
ggcaccgcggagctggcgcgtcacgtcgcgaccggattgcaagaccgcgacgcgtgcctg
atggcgaaccacggacagatcgcgatcggcccgacgctcggtcatgcgctggagcttgcc
gccgaagtcgaggcacttgctgagcaatactacaaggtgctgaccctcggccccgcgaac
atcttgaacgacgacgagatggcgctgctgctcgacaagttcaaaacctacggccgcaac
gtcgccgaaaagtaa

DBGET integrated database retrieval system