KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_2900Help
Entry
Hden_2900         CDS       T01265                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Pathway
hdn00260  Glycine, serine and threonine metabolism
hdn00750  Vitamin B6 metabolism
hdn01100  Metabolic pathways
hdn01110  Biosynthesis of secondary metabolites
hdn01120  Microbial metabolism in diverse environments
hdn01230  Biosynthesis of amino acids
Module
hdn_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hdn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hden_2900
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Hden_2900
Enzymes [BR:hdn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Hden_2900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: ADJ24696
UniProt: D8JUR6
Position
complement(2992457..2993857)
Genome map
AA seq 466 aa AA seqDB search
MKYISTRGGAEALGFEDVLLAGLARDGGLYVPEVWPTLTPDTIASFRDKPFVEIAVEVIH
PFTGDEISRDELRRMASEAYATFDTSEVTPLVEIKPGLTILELFHGPTLAFKDVAMQLLA
RLMDHVLEKRGARATIVGATSGDTGGAAIEAFRSSKRVDVVILFPKGRVSDVQRRMMTTP
TEPNVHAVAIEGTFDDCQALVKAMFNDHAFRDRVELSGVNSINWARIVAQVTYYFWAASR
IGTTEPLSFSVPTGNFGDIFASYVAKRLGLPIDKLIIASNENDILPRAVATGVYAMKDVI
ATSSPSMDIQISSNFERYLFEASDRDADFVRSSMTSLIATGSFELGRTGSRLKQDFAAVS
ASEADVADAIRRTKTAYGYVLDPHTACAFVAAERVAPAGNTVILSTAHPAKFPDAIEAIT
GARPALPAHQAHLMTDAEKFDTLPNSLSSVQKFVLKHCRVAAGTPQ
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
ttgaaatacatttctactcggggcggggcggaagcgctcgggttcgaagatgtcctgctt
gccggattggcgcgcgacggcggtctgtacgtccccgaagtctggccgacgctgacgcct
gacacgatcgcgtcgtttcgcgacaagccgttcgtcgaaatcgctgtcgaggtcatccat
ccttttaccggcgacgagatctcgcgcgatgaactgcgccgcatggcgtcggaagcctac
gcgaccttcgatacgtccgaggtgacgccgctcgtcgaaatcaaacccggcctgaccatc
ctcgaattgttccacggcccgacgctcgccttcaaagacgttgcgatgcaactcctggcg
cggctgatggatcacgtgctcgagaagcgcggcgctcgcgccaccatcgtcggcgcgacg
tcgggcgataccggcggcgcggccatcgaagccttccgctcgtcgaagcgcgtcgacgtc
gtgatcctgtttcccaaaggccgcgtgtccgacgttcaacgccgcatgatgacgacgccg
acggaaccgaacgtccatgccgtcgcgatcgaaggcacgttcgacgactgtcaggcgctc
gtcaaagcgatgttcaacgatcacgcgtttcgggatcgcgtcgagctgtccggcgtcaat
tcgatcaactgggcccgcatcgtcgcgcaggtcacttactatttctgggcggcgtcgcgc
atcggaaccaccgagccgttatcgttttccgtaccgaccggaaacttcggcgacattttt
gcgagctacgtcgcaaagcgcctgggtctcccgatcgacaagctcatcatcgcctcgaac
gaaaacgatatcctgccgcgcgccgtcgcgacgggcgtctatgcgatgaaggacgtcatc
gccacgtcgtcgccctcgatggacattcagatctcgtcgaatttcgagcgctatctgttc
gaggcgtcggatcgtgacgccgattttgtccgcagctcgatgacatcgctgatcgccacc
gggagtttcgagcttggccgcacaggctcgcgcttgaagcaggatttcgccgctgtctcg
gcatcggaagccgacgtcgcggatgcgatccgccgcacgaaaaccgcatatggctatgtt
ctcgatccgcacacggcgtgcgcgttcgtagccgccgagcgtgtcgctccggcggggaac
accgtcattctctcgacggcgcaccctgcgaagtttccggacgcaatcgaagccattacc
ggtgcgcgcccggctttgcccgcgcatcaagcgcatctcatgaccgatgcagagaaattc
gatacgctgccgaacagtctctcgtcggtgcagaagttcgtcttgaagcattgccgcgtg
gcggccggaacccctcaatga

DBGET integrated database retrieval system