KEGG   Hyphomicrobium denitrificans ATCC 51888: Hden_3229Help
Entry
Hden_3229         CDS       T01265                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
hdn  Hyphomicrobium denitrificans ATCC 51888
Pathway
hdn00020  Citrate cycle (TCA cycle)
hdn00640  Propanoate metabolism
hdn00660  C5-Branched dibasic acid metabolism
hdn01100  Metabolic pathways
hdn01110  Biosynthesis of secondary metabolites
hdn01120  Microbial metabolism in diverse environments
hdn01130  Biosynthesis of antibiotics
hdn01200  Carbon metabolism
Module
hdn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hdn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hdn00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Hden_3229
   00640 Propanoate metabolism
    Hden_3229
   00660 C5-Branched dibasic acid metabolism
    Hden_3229
Enzymes [BR:hdn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Hden_3229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ADJ25023
UniProt: D8JWR5
Position
complement(3305045..3306244)
Genome map
AA seq 399 aa AA seqDB search
MNIHEYQAKELYRAYGVPTPNGFAAFSVAEAVEAAKKLPGPVWVVKAQIHAGGRGKGKFL
EASAGDKGGVRLAKSIDEVKEFAEQMLGKTLVTVQTGNAGRVVNRLYIEDGSAIDRELYL
SALVDRSTSRVAFIVSQAGGMNIEDVAHETPEKIHTLTIDPATGYQPFHGRKVAFALGLK
GDQVKAAGKLVENLYRMVVEKDMSLLEINPLVVTKDGKLICLDGKMNFDSNALYRHPEIV
ELRDLGEEDQTEIEASKHDLAFVKLDGNIGCLVNGAGLAMATMDIIKLYGAEPANFLDVG
GGASKEKVREAFKIILADPSVKGILVNIFGGIMRCDIIAEGVIAAAREMDIKVPLVVRLE
GTNVDLGKKILKESGLKIIPADDLADAAKKITDELKQVA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccacgaatatcaggccaaagagctgtatcgcgcctatggcgtcccgacgccg
aacggtttcgcggcgttctcggtcgccgaagcggttgaagcggcgaagaaacttcccggg
ccggtgtgggtggtcaaagcgcaaattcatgccggaggccgcggcaaaggcaaattcctt
gaagcgtctgcaggcgacaaaggcggggttcgcctcgccaaatcgatcgacgaggtgaag
gaattcgccgagcagatgctgggtaaaacgctcgtcacggtccagaccggaaacgccggg
cgcgtcgtcaatcggctctatatcgaggacggctccgcgatcgatcgcgagctttatctc
tccgcgctcgtcgatcgttcgacgtcgcgtgtcgccttcatcgtcagccaggcgggcggc
atgaacatcgaagacgtcgcgcacgaaacgccggaaaaaattcacactctgacgatcgat
cccgccaccggctatcagccgtttcacggccgcaaggttgccttcgcgctgggcctcaag
ggtgatcaggtgaaggcggcgggcaagctcgtcgagaacctctaccgcatggtcgtcgag
aaggacatgagtctgctcgagatcaatccgctggtcgtcaccaaggacggcaagctcatc
tgcctcgacggcaagatgaatttcgactccaacgccctttatcggcaccccgaaatcgtc
gagctgcgcgacctcggcgaagaagatcagaccgagatcgaagcctcgaagcacgacctc
gcgttcgtcaagctcgacggcaacatcggctgcctcgtcaacggtgccggcctcgcaatg
gcgacgatggacatcatcaagctttatggtgcggagcccgccaacttcctcgacgtcggc
ggcggtgcgtcgaaggaaaaggtgcgcgaagccttcaagatcatcctcgccgacccgtcc
gtgaagggcatcctggtcaatatcttcggcggcatcatgcgttgtgacatcatcgcggaa
ggcgtgatcgcggcggcccgcgaaatggacatcaaagtgcccctcgtcgtgcgccttgaa
ggcaccaacgtcgatctgggtaagaaaatcctaaaggagtcgggtctcaagatcattccc
gccgacgaccttgcggatgccgccaaaaagatcaccgacgagttgaaacaggtcgcctga

DBGET integrated database retrieval system