KEGG   Hyphomicrobium denitrificans 1NES1: HYPDE_30528Help
Entry
HYPDE_30528       CDS       T02646                                 

Definition
(GenBank) methionyl-tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
hdt  Hyphomicrobium denitrificans 1NES1
Pathway
hdt00450  Selenocompound metabolism
hdt00970  Aminoacyl-tRNA biosynthesis
hdt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hdt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    HYPDE_30528
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    HYPDE_30528
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hdt01007]
    HYPDE_30528
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hdt03016]
    HYPDE_30528
Enzymes [BR:hdt01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     HYPDE_30528
Amino acid related enzymes [BR:hdt01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   HYPDE_30528
Transfer RNA biogenesis [BR:hdt03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    HYPDE_30528
 Prokaryotic type
   Other AARSs
    HYPDE_30528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f DUF4031 Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AGK57780
UniProt: N0BCC7
Position
complement(1594074..1595747)
Genome map
AA seq 557 aa AA seqDB search
MTANRSFSEVSRVWRPRAAVEPRALLRPTTIDKEAHPLREKFYITTAISYPNGVPHIGHA
YEAIATDVIARFERLDDKDVFFLTGTDEHGLKMKQTAEREGVTPRALADRNTARFIEMAK
TLGLSNDDFIRTTEKRHYDACAELWRRMEKAGDIFKRPYGGWYSVRDETYYKESETEVRD
GQRFATSTGTPVEWNEEETYFFRLSAYQDKLLAHYEANPDFILPAERRNEVVSFVKMGLE
DLSISRTTLDWGIPVPDAAGHVMYVWIDALNNYVTATGLLTDPQGARAHYWPADVHVIGK
DIVRFHAVYWPAFLMSAGLALPKRIFSHGFVLNKGEKMSKSVGNVVDPFDLVKAYGRDAV
RYFFLREVMFGQDGNYSPEAIANRINADLANNLGNLAQRSLSMIFKNCDGAIPAPGAFST
EDTAILEAADALYGLARREMDRQAITKYLDAVWNVVADANRYFAAEEPWAKKKTDPARMA
TILYVTAECVRQFAILVQPVMPESAAKLLDLLAVPAEARTFANLGVAGRLTAGAPIPEPQ
GVFPRYVDPDEPKGKKS
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgcaaatcgctcattctcggaagtttcgcgcgtctggaggccgcgagccgccgtt
gagcccagggctctgctgcgcccaacgaccatcgacaaggaagctcacccgttgcgcgaa
aaattctatattacgacggctatctcctacccgaacggcgtgccgcatatcgggcacgcc
tacgaggccatcgcgaccgacgtcatcgcacgcttcgagcggctcgacgataaggatgtt
ttcttcctgacgggcaccgacgagcacggcctcaagatgaagcagacggccgagcgcgaa
ggcgtcactccgcgagcccttgccgatcgcaacaccgcgcgtttcatcgaaatggcgaag
acgctcggtctctcgaacgacgatttcatccgcacgacggaaaagcgccattacgacgct
tgtgcagaactctggcgtcgcatggagaaagcgggcgatattttcaagcgcccttacggc
ggctggtattctgtgcgcgacgagacctactacaaggaaagcgagacggaagtccgcgac
gggcagcgctttgcaacatcgacgggaacgcctgtcgagtggaatgaagaagagacctac
ttcttccgcctctcggcttatcaggacaagctgctcgcgcattacgaagccaatcccgac
ttcatcctgcccgccgagcgccggaacgaggtcgtcagcttcgtgaagatggggctcgaa
gatttatcgatttcgcgcacgacgctcgattggggcattccggtgcctgatgcggcgggc
cacgtcatgtacgtctggatcgatgcgttgaacaactacgtgacggcgaccggccttttg
accgacccgcaaggtgcgcgcgcacactactggcccgccgacgtgcacgtcatcggcaag
gatatcgtgcgctttcacgccgtctattggcctgccttcctgatgagcgccgggctggcc
ctgccgaagcgcatcttcagccacgggttcgtgctgaacaagggtgaaaagatgtcgaag
tcggtcggcaacgtcgtcgatccgttcgatctcgtcaaagcctatggccgcgatgccgtc
cgctatttcttcctgcgcgaagtcatgttcggtcaggacggcaactattcgccggaagcg
atcgcaaaccgcatcaatgccgaccttgcgaacaacctcggcaacctcgcacagcgctcg
ctgtcgatgatcttcaagaactgcgacggcgccattccggctcccggcgcgttcagcacg
gaagatacagcgatcctggaggccgccgatgcgctctatggactcgcacggcgcgagatg
gatcgccaggcgatcacgaaatacctcgacgccgtctggaacgtcgtcgccgacgcgaac
cgctatttcgcggccgaggaaccatgggcgaaaaagaagactgatccggcgcgcatggcg
acgatcctctacgtcactgccgagtgcgtgcgccaattcgcaattcttgtacagccggtg
atgccggaaagcgcggcgaaattgctcgacctgcttgcggttccggcagaagcgcgcaca
tttgcaaatctcggggtagcagggcgcctgacggcaggcgccccgatcccggagccgcag
ggcgttttcccacggtatgtcgatccggatgagcccaagggtaagaaatcttga

DBGET integrated database retrieval system