KEGG   Hyphomicrobium denitrificans 1NES1: HYPDE_35138Help
Entry
HYPDE_35138       CDS       T02646                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
hdt  Hyphomicrobium denitrificans 1NES1
Pathway
hdt00970  Aminoacyl-tRNA biosynthesis
hdt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hdt00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    HYPDE_35138
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hdt03029]
    HYPDE_35138
Enzymes [BR:hdt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     HYPDE_35138
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     HYPDE_35138
Mitochondrial biogenesis [BR:hdt03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    HYPDE_35138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AGK58699
UniProt: N0B592
Position
complement(2486263..2487744)
Genome map
AA seq 493 aa AA seqDB search
MSSQKVAVKSKPNNLIAGATGDWEVIIGMEVHAQVASNAKLFSGASTAFGAEPNSHVSLV
DAAMPGMLPVINKECVAQAIRTGLGLKAEINLKSVFDRKNYFYPDLPQGYQISQYKQPVV
GEGEVEIDADGETMRVGIERLHLEQDAGKSLHDQHPDYSYVDLNRSGVALMEIVSKPDLR
SSKQAQAYVTKLRSILRYLGTCDGDMEKGNLRADVNVSVRKPGDKLGTRCEIKNVNSIRF
IGQAIEAEARRQIDIIEDGGTIDQETRLFDSAKGETRSMRSKEEAHDYRYFPDPDLLPLE
LTQDYVEGLKSELPELPDEKRARFMKAFGLSAYDADVLVAERSSADYFESVANGRDGKLA
ANWVINELFGRLNKEGKDIETCPMSAQQLGAIVDLISSNAISGKIAKDLFEIVWMEGGDP
AEIVDKRGMKQVTDTGAIEKAVDAIIASNPDKVEQAKAKPSMLGWFVGQVMKATGGKANP
AAVNEILKAKLGI
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgagttctcagaaagtcgctgtgaaatccaaaccgaacaaccttatcgcgggcgccacc
ggcgattgggaagtcatcatcggcatggaggttcacgctcaggtcgcttcgaacgcgaag
ctgttttccggcgcttcgacagcattcggcgctgagccgaacagccatgtctcgctggtc
gatgcggcgatgccgggaatgctccccgtcatcaacaaggagtgcgtcgcgcaggcgatc
cgcaccggtctcggtctcaaggctgagatcaatttgaagagcgtcttcgatcgcaagaac
tacttttatccggatctgccgcagggctatcagatctcgcagtataaacaacccgtggtc
ggcgaaggcgaggtcgagatcgacgccgacggcgaaacaatgagggtcggcatcgagcgc
ttgcacctcgaacaggatgcaggaaaatcgctgcacgaccagcacccggattattcctac
gtcgacctcaatcgctcgggcgtcgcgctgatggagatcgtctcgaaacccgatctcaga
tcgtcgaagcaggctcaggcctacgtcacgaaactgcgcagcatcctccgttacctcggt
acctgcgatggcgacatggagaaaggcaacctgcgcgctgacgtcaacgtgtcggtccgc
aagcctggcgataagctcggcacgcgatgcgaaatcaaaaacgtcaactcaattcgtttc
atcgggcaggcgatcgaagcggaagcccgccgccagatcgatatcatcgaggatggcggc
accatcgatcaggaaacgcggctgttcgattccgcaaagggcgaaacgcgctcgatgcgc
tcgaaggaagaagcgcacgactatcgctacttccctgatcccgacctgttgccgctcgaa
ctgacgcaggattacgtagaaggtctcaaatcggagttgccggagcttcctgatgaaaag
cgcgcgcgcttcatgaaagcattcggtttatcggcctacgacgccgacgtgctcgtggcc
gagcgctcgtcggccgattacttcgagagcgtcgccaacggccgtgacggcaagctcgcg
gcgaactgggtcatcaacgagctcttcggccgcctgaacaaggaaggcaaggacatcgag
acttgccccatgtcggctcagcagctcggcgccatcgtcgatctcatttcatcgaatgca
atttcgggaaagatcgcaaaggatcttttcgagatcgtctggatggaaggcggagaccct
gccgagatcgtcgacaagcgcggcatgaagcaggtgaccgataccggcgccatcgaaaag
gcggtcgacgcgatcatcgcttccaatcccgacaaggtcgagcaggcgaaagctaagcct
tcgatgcttggatggttcgtcggtcaggtcatgaaggcaacaggcggcaaagccaatcct
gcggcggtcaatgagatcctgaaggccaagctcgggatctaa

DBGET integrated database retrieval system