KEGG   Hyphomicrobium denitrificans 1NES1: HYPDE_35153Help
Entry
HYPDE_35153       CDS       T02646                                 

Gene name
gatA
Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
hdt  Hyphomicrobium denitrificans 1NES1
Pathway
hdt00970  Aminoacyl-tRNA biosynthesis
hdt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hdt00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    HYPDE_35153 (gatA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hdt03029]
    HYPDE_35153 (gatA)
Enzymes [BR:hdt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     HYPDE_35153 (gatA)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     HYPDE_35153 (gatA)
Mitochondrial biogenesis [BR:hdt03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    HYPDE_35153 (gatA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AGK58702
UniProt: N0B8T7
Position
complement(2488452..2489951)
Genome map
AA seq 499 aa AA seqDB search
MTDLTKLTMAEARDGLKKKSFSALELTDAFLSAIDAANPALNAYVLQTPEHARAQAKESD
KRIAAGQARPLEGLPIGNKDLFCTNGIRTTACSKILDDFKPPYESTVGQNLWDAGAVMLG
KLNNDEFAMGSSNETSAFGNVVSPWRRKGADGKLSEDKLVPGGSSGGSSAAVAADLCLAA
TATDTGGSIRQPAALTGTVGMKPTYGRCSRWGIVAFASSLDQAGPIAKTVRDAAIMLKTM
ASHDSKDTTSVDAPVPDYEAAVGKGVKGLRVGVPKEYRVEGMSPEIQKLWDEGIAWLKAA
GATIHEISLPHTKYALPAYYIVAPAECSSNLARYDGMRYGLRINGDNLTDTYEKTRAAGF
GKEVRRRILIGTYVLSAGYYDAYYLKAQKVRTLIKRDFDQAWDKVDVVLTPTTPSPAFAF
GEKTGDPLAMYLEDIFTVTVNMAGLPGMSVPAGLSSQGTPLGLQLIGKPFDEETLFRTAQ
VIEDAAGRFAVPAKWWTKG
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
gtgacggatcttaccaagctgacgatggccgaggcccgtgacggcctcaagaaaaagtcc
ttttctgcgcttgagctgacggatgcattcctttcagcaatcgatgcggcgaacccggcg
cttaacgcctacgtgctgcagactcccgagcatgcgcgtgcacaggcgaaggaaagcgac
aagcggattgccgccggtcaggcgcgccccctcgaagggcttccgatcggcaacaaggac
ctcttctgcacgaatggcatccgcacgacggcgtgctcgaagatcctcgacgatttcaag
ccgccatatgaatcgacggtcggacaaaatctctgggatgccggcgccgtcatgctcggt
aaactcaataacgacgagttcgcgatgggctcgtcgaacgagacgagtgccttcggcaac
gtcgtgagcccatggcgccgcaaaggtgcggatggcaagctctcggaagataagctcgtt
cctggcggctcgtccggtggctcgtctgccgccgttgcggccgatctttgccttgccgcg
acagcaaccgatacgggcggctcgatccgccagcccgccgcgctgacaggtaccgtcggt
atgaagcccacatacggacgctgctcgcgctggggcattgtcgcgttcgcctcgtcgctc
gatcaggccggtccgatcgccaagacagtccgcgacgcggcaatcatgctgaaaacgatg
gcgagtcacgattcgaaggacacgacatcggtcgatgcaccggttcctgactacgaagcc
gcggtcggcaaaggcgtcaagggattgcgcgtcggcgtgccaaaggaatatcgcgtcgag
ggcatgtcgcccgaaattcagaaactatgggatgaaggcatcgcgtggctgaaggccgcc
ggagcgacgatccatgagatttctttgccgcacacgaaatacgcgctgcctgcatattac
atcgtcgcaccggccgaatgctcttcgaacctcgcacgctacgatggcatgcgttacggt
ctccgcatcaacggcgataatctgacggacacctacgaaaaaacgcgcgctgccgggttc
ggcaaagaagttcgccgccgcatcctgatcggcacctatgtgctgtccgccggatattac
gacgcttattatctcaaggctcagaaggtgcgcaccctgatcaagcgcgacttcgaccaa
gcttgggacaaggtcgatgtagtgctgacgccgacgacgccgtcgcccgcattcgcgttt
ggagaaaagaccggcgatccgttggcgatgtatctcgaggatatcttcacggtcacggtg
aacatggccggtctgcccggcatgtcggttccggctgggctgtcctctcaaggtacgccg
ctcggtctgcagctcatcggcaagccgttcgacgaggagacgctgttccggacggctcaa
gtgattgaagatgcggcaggccggtttgccgtgccggccaagtggtggacgaagggttag

DBGET integrated database retrieval system