KEGG   Hyphomicrobium denitrificans 1NES1: HYPDE_37618Help
Entry
HYPDE_37618       CDS       T02646                                 

Definition
(GenBank) acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hdt  Hyphomicrobium denitrificans 1NES1
Pathway
hdt00071  Fatty acid degradation
hdt00072  Synthesis and degradation of ketone bodies
hdt00280  Valine, leucine and isoleucine degradation
hdt00310  Lysine degradation
hdt00362  Benzoate degradation
hdt00380  Tryptophan metabolism
hdt00620  Pyruvate metabolism
hdt00630  Glyoxylate and dicarboxylate metabolism
hdt00640  Propanoate metabolism
hdt00650  Butanoate metabolism
hdt00900  Terpenoid backbone biosynthesis
hdt01100  Metabolic pathways
hdt01110  Biosynthesis of secondary metabolites
hdt01120  Microbial metabolism in diverse environments
hdt01130  Biosynthesis of antibiotics
hdt01200  Carbon metabolism
hdt01212  Fatty acid metabolism
hdt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hdt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HYPDE_37618
   00630 Glyoxylate and dicarboxylate metabolism
    HYPDE_37618
   00640 Propanoate metabolism
    HYPDE_37618
   00650 Butanoate metabolism
    HYPDE_37618
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HYPDE_37618
   00072 Synthesis and degradation of ketone bodies
    HYPDE_37618
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HYPDE_37618
   00310 Lysine degradation
    HYPDE_37618
   00380 Tryptophan metabolism
    HYPDE_37618
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HYPDE_37618
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HYPDE_37618
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HYPDE_37618
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hdt04147]
    HYPDE_37618
Enzymes [BR:hdt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HYPDE_37618
Exosome [BR:hdt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HYPDE_37618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Robl_LC7 7TMR-HDED ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AGK59195
UniProt: N0BGD4
Position
complement(2991883..2993073)
Genome map
AA seq 396 aa AA seqDB search
MSEDSSTIVIASAARTPVGSFNGALASLPASKLGEIAIKAALKRANVQPGDVSEVILGQV
LTAAQGQGPARQASVGAGVPVDSPAWSVNQICGSGLRAVALGMQQIKTGDAKIVVAGGQE
SMSQSNHAAHMRDGTKMGDLKLVDTMVKDGLWDAFNNYHMGTTAENVARQWQITRDEQDK
FAVASQNKAEAARKAGKFKDEITPVTIKTKKGETVVDQDEYIKEGVTLESVSKLRPAFDP
KEGTVTAANASGINDGAAVVVLMTAEEAKKRGIKPLARIVSWATTGVDPSIMGTGPISAS
KKALEKAGWTINDLDLIEANEAFAAQALAVNKGLGWDTDKVNVNGGAIAIGHPIGASGAR
ILNTLLFEMQRRDAKKGLATLCIGGGMGVAMCVARD
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagattcgtcgacaattgtgattgcaagcgcagctcgaacgcctgtcggctcg
tttaacggcgcgctggcgtccttgccggcctctaaacttggcgaaattgcaatcaaggcc
gcccttaagcgcgccaatgttcagcctggagacgtttcggaggtcatccttggtcaggtt
ctgacggcggcgcagggccaggggccggcacgtcaggcatccgtcggtgctggggtcccg
gtcgattctcccgcctggagcgtcaatcagatttgcggttcgggtctcagagccgtcgca
ctcggcatgcagcagatcaagaccggagacgcgaagattgtcgttgccggtggccaggag
agcatgagccagtcgaaccacgcggcgcacatgcgcgacggcacgaagatgggcgacttg
aagcttgtcgacaccatggtcaaggacggcctctgggacgccttcaacaattaccacatg
ggcacgacggccgagaacgttgcacgccagtggcagatcacgcgcgacgagcaggacaag
ttcgctgtcgcttcccagaacaaggctgaagccgcacgcaaggccggcaagttcaaggac
gagatcacgccggtcacgatcaagaccaagaagggcgagaccgtcgtcgatcaggacgaa
tacatcaaggaaggcgtaacgctcgaaagcgtctccaaactccgcccggcgttcgatccg
aaggaaggcacggtcaccgctgccaacgcgtcgggcattaacgacggtgctgcggtcgtc
gtgctgatgactgcggaggaagccaagaaacgcggtatcaaaccgctcgcgcgcatcgtg
tcgtgggcgaccaccggcgtcgatccctccatcatgggaaccggcccgatctcggcatcg
aagaaagcgctcgaaaaggccggctggacgatcaatgatctcgatctcatcgaagccaac
gaagctttcgcggcacaagctcttgccgtcaacaagggtctcggctgggataccgacaag
gtcaacgtgaacggtggcgcgatcgccatcggacatccgatcggcgcctcaggcgctcgc
attctcaatacgcttcttttcgaaatgcagcgccgtgacgcgaagaagggccttgccacc
ctttgcatcggcggcggcatgggtgtcgccatgtgcgtcgcgcgcgactaa

DBGET integrated database retrieval system