KEGG   Haemophilus ducreyi: HD_0624Help
Entry
HD_0624           CDS       T00135                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
hdu  Haemophilus ducreyi
Pathway
hdu00473  D-Alanine metabolism
hdu01100  Metabolic pathways
hdu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hdu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    HD_0624 (alr)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    HD_0624 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hdu01011]
    HD_0624 (alr)
Enzymes [BR:hdu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     HD_0624 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:hdu01011]
 Precursor biosynthesis
  Racemase
   HD_0624 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AAP95551
UniProt: Q7VNC9
Position
complement(485783..486907)
Genome map
AA seq 374 aa AA seqDB search
MKPAIATISRQALRHNIQLIKKLAPKQKLLAMIKANAYGQGLLPAAATLADLVDGFGVAR
LHEALEVQETGYTGKILLVEGFFDREELLKTLSRGFDTVIHCLEQLELLEQVAKEWQIEQ
QKRFWQRKTKIYFPINIWLKIDTGMHRLGIHPEQVDLFYARLKSCPLVATISFMSHFSRA
DELDCGYTEQQIATFEMATEQYSAHSRSIAASSGILYWPQAHYEWVRPGIIMHGISPHYQ
PITQLGFKPVMTLSSTLIAIRSHKAGEPVGYGGAWISDKATTLGVVAMGYGDGYPRNAPE
GTPVLINGRIVPIVGRVSMDMLTVDLGIDSQDQVGDEVILWGNDLLIETVAQHIGVISYE
LITKLTPRVIFEYR
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccagccatagcgactattagccgtcaggcacttcgccataatattcaattgatc
aaaaaattagcgcctaagcaaaaactattggccatgattaaagcaaatgcttacgggcaa
ggtttattacccgctgctgcaacattagctgatttagtcgatggctttggtgttgcacgt
ttacacgaagcgcttgaagtgcaagaaacgggctatactggcaaaattttattagttgaa
ggtttttttgatcgagaagaattattaaaaacgctgtctcgtggctttgataccgttatt
cattgcctagaacagttagaattattagagcaagtcgcaaaagaatggcaaattgagcaa
cagaaaagattttggcaacgtaaaactaaaatttatttcccgatcaatatttggctaaag
attgataccggaatgcatcgtttaggcattcatcctgagcaagttgatctattttatgcc
cgcttaaaaagctgtcctttggttgccactattagctttatgagccattttagtcgcgcc
gatgaactggattgtggttataccgaacaacagattgctacttttgaaatggcaacagag
caatattctgcacattcgcggagtattgctgcttcaagcggtattctttattggccacaa
gcgcattatgagtgggttcgtcccggcattatcatgcatggtatctcgcctcattatcaa
ccaatcactcaattaggctttaagcctgtgatgacgctttcttctaccttaatagcgatc
cgcagccataaagcaggtgaaccggttggctatggtggggcttggataagcgataaagcc
acaacattaggtgtcgtggcaatgggctatggtgatggctaccctcgaaatgcaccagaa
ggcacgcccgtattaatcaatgggcggatcgtgccaatcgttgggcgagtatcaatggat
atgttgacggtcgatcttggcatagatagtcaagatcaggttggtgatgaagttatttta
tggggtaacgatttattaattgaaacagttgcccaacatattggtgtgatcagctatgag
ttgatcactaaactcacaccacgtgtcatttttgaatatcgttaa

DBGET integrated database retrieval system