KEGG   Haemophilus ducreyi: HD_1138Help
Entry
HD_1138           CDS       T00135                                 

Definition
(GenBank) probable pseudouridine synthase Rlu family protein
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
hdu  Haemophilus ducreyi
Brite
KEGG Orthology (KO) [BR:hdu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hdu03016]
    HD_1138
Enzymes [BR:hdu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     HD_1138
Transfer RNA biogenesis [BR:hdu03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    HD_1138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AAP95999
UniProt: P59840
Position
complement(904995..905726)
Genome map
AA seq 243 aa AA seqDB search
MELDILYRDDELIAINKPAGMLVHRSWLDKAETLFAMQTLRDQINQHVFPIHRLDRPTSG
VLLFALNSEMARLMSEQFEQHKVEKEYLAIVRGYIAEKGEIDYPLKVILDKIADKFSQPK
AAQQAVTFYQNLAKVEMPYSTGKYATTRYSLVALSPKTGRKHQLRRHMKHLFHPIMGDTK
YGDLHQNRRLTEKTGCNRLMLHARLLHFTHPKTLQKITISALLDQQWQMLFNQFGWHFTD
FFY
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggaacttgatattttataccgtgatgatgaactgattgcaattaataaaccggcggga
atgttagtccatcgttcgtggctggataaagcagaaacattatttgcgatgcaaacattg
cgtgatcaaatcaaccaacacgtttttcctattcaccggctagatcgccctacttcgggc
gtacttttgtttgccttaaatagcgaaatggctcgcttgatgagtgaacaatttgaacaa
cataaagtcgaaaaagaataccttgcgattgttcgtggctatatcgcagaaaaaggtgaa
attgattacccacttaaagtgatattagacaaaattgcggataaattttcccaaccaaaa
gcagcgcaacaagcggtcactttttatcaaaatcttgcaaaagtagagatgccttattcc
acaggtaaatatgccactacgcgttatagtttagttgcattatcaccgaaaacgggcaga
aaacatcagcttagacggcatatgaaacatttatttcatccgattatgggcgatacgaaa
tatggcgatttacatcaaaaccggcgattaactgaaaaaacgggctgtaatcgtttaatg
ttacacgctcgtttgctacactttacccacccgaaaacattgcaaaaaatcaccatttct
gcactgcttgatcagcaatggcagatgttattcaaccaatttggttggcatttcactgat
ttcttttactag

DBGET integrated database retrieval system