KEGG   Haemophilus ducreyi: HD_1473Help
Entry
HD_1473           CDS       T00135                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
hdu  Haemophilus ducreyi
Pathway
hdu00240  Pyrimidine metabolism
hdu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hdu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    HD_1473 (tdk)
Enzymes [BR:hdu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     HD_1473 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 KdpD AAA_30 AAA_14 DUF2075 Arc_PepC TniB SNF2_N
Motif
Other DBs
NCBI-ProteinID: AAP96275
UniProt: Q7VLH2
Position
1207853..1208449
Genome map
AA seq 198 aa AA seqDB search
MAKLYFYYSAMNAGKSTTLLQSSYNYQERGMNTLVYTAAIDDRYGIGKVCSRIGISQEAK
LFYTDTNFLEQVEQVLKAKKLHCIMIDEAQFLTKKQVHQLTDVVDELKIPVLCYGLRTDF
QKELFEGSQYLLAWADELQELKTICECGKKAHFVIRLNENGETVTTGEQIQIGGNDKYIS
VCRYHYKKKRGELRQITK
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactttatttttattattctgcaatgaatgcaggtaaatcgactactctgctt
cagtcttcttataattatcaagaacgcggtatgaatacgttagtttatactgcggcaatt
gatgatcgttatgggataggcaaagtctgttcacgtattggtatttcgcaagaagcaaaa
ctattttatacagatacaaactttctagagcaagttgagcaagtccttaaggctaaaaaa
ttacactgtattatgattgatgaagcgcaatttctaactaaaaagcaagttcatcaattg
acggatgtggttgatgaattaaagattcctgtgctttgttatgggctacgaactgatttt
caaaaagagttatttgaggggagccagtatttattagcttgggcggatgaattgcaagag
ttaaaaacaatttgtgaatgtggaaaaaaagcgcattttgtcattcgtttaaacgagaat
ggtgaaacggttacaacaggtgagcaaattcagattggcgggaatgataagtatatttca
gtttgtcgttatcactataaaaaaaaacgaggtgaattaaggcaaattactaaataa

DBGET integrated database retrieval system