KEGG   Herbiconiux sp. SALV-R1: HL652_05835
Entry
HL652_05835       CDS       T06594                                 

Definition
(GenBank) mycofactocin-coupled SDR family oxidoreductase
  KO
K12466  (+)-trans-carveol dehydrogenase [EC:1.1.1.275]
Organism
hea  Herbiconiux sp. SALV-R1
Pathway
hea00903  Limonene and pinene degradation
hea01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hea00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    HL652_05835
Enzymes [BR:hea01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.275  (+)-trans-carveol dehydrogenase
     HL652_05835
SSDB
Motif
Pfam: adh_short_C2 adh_short KR NPV_P10
Other DBs
NCBI-ProteinID: QJU53196
UniProt: A0A6M5J409
Position
1185477..1186310
AA seq 277 aa
MGRVEGKVAFITGAARGQGRSHALRLAQEGADIIAIDICEPVAANNAPPATEEDLAETVR
QVEALDRRIVAAKADVRDFEQLKSVLDDGVAQLGRLDIVSANAGIAGSPNRAEDIPDEEW
ADMVDINLNGVWRTAKAAIPHLKAGGNGGSIILTSSDAGIFAYPNIAHYVSAKHGVVGLM
RTLALELAPDFIRVNSIHPTTVDTPMVQNEGTYKLFRPDLENPTQKDFADSAIAMNAIPI
PWVDAVDISNAVLWLASDESRYVTGVMLPVDAGAAIK
NT seq 834 nt   +upstreamnt  +downstreamnt
atggggcgtgtagagggaaaggtcgcgttcatcacgggcgctgcacgaggtcaagggcgc
agccacgcgctgcggctcgcccaggagggcgccgacatcatcgccatcgacatctgcgag
ccggtcgccgcgaacaacgcgccgcccgccaccgaagaagacctcgccgagaccgtgcgc
caggtcgaggcgctcgaccgccgcatcgtcgccgccaaagccgacgtgcgcgacttcgag
cagctgaagtcggtgctcgacgacggggtcgcccagctcgggcggctcgacatcgtctcg
gccaacgccggcatcgccgggtcgccgaaccgggccgaagacattcccgacgaggaatgg
gccgacatggtcgacatcaacctcaacggcgtgtggcgcacggcgaaggccgccatcccg
cacctcaaggccgggggcaacggcgggtcgatcatcctcaccagttccgacgccggcatc
ttcgcctacccgaacatcgcgcactacgtctcggcgaagcacggagtggtcgggctcatg
cgcaccctggcgctcgaattggcacccgacttcatcagggtgaacagcatccaccccacc
accgtcgacacgcccatggtgcagaacgagggcacgtacaagctgttccggcccgacctc
gagaacccgacgcagaaggacttcgccgacagcgccatcgcgatgaacgccatccccatt
ccgtgggtcgacgccgtcgacatctcgaacgcggtgctctggctggcctccgacgagtcg
cgctacgtcacgggggtcatgcttcccgtcgacgccggtgcggccatcaagtga

DBGET integrated database retrieval system