KEGG   Helicobacter pylori BM012A: U063_0994Help
Entry
U063_0994         CDS       T02939                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
heb  Helicobacter pylori BM012A
Pathway
heb00071  Fatty acid degradation
heb00072  Synthesis and degradation of ketone bodies
heb00280  Valine, leucine and isoleucine degradation
heb00310  Lysine degradation
heb00362  Benzoate degradation
heb00380  Tryptophan metabolism
heb00620  Pyruvate metabolism
heb00630  Glyoxylate and dicarboxylate metabolism
heb00640  Propanoate metabolism
heb00650  Butanoate metabolism
heb00900  Terpenoid backbone biosynthesis
heb01100  Metabolic pathways
heb01110  Biosynthesis of secondary metabolites
heb01120  Microbial metabolism in diverse environments
heb01130  Biosynthesis of antibiotics
heb01200  Carbon metabolism
heb01212  Fatty acid metabolism
heb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:heb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    U063_0994
   00630 Glyoxylate and dicarboxylate metabolism
    U063_0994
   00640 Propanoate metabolism
    U063_0994
   00650 Butanoate metabolism
    U063_0994
  09103 Lipid metabolism
   00071 Fatty acid degradation
    U063_0994
   00072 Synthesis and degradation of ketone bodies
    U063_0994
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    U063_0994
   00310 Lysine degradation
    U063_0994
   00380 Tryptophan metabolism
    U063_0994
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    U063_0994
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    U063_0994
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    U063_0994
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:heb04147]
    U063_0994
Enzymes [BR:heb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     U063_0994
Exosome [BR:heb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   U063_0994
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AHA88340
Position
1016153..1017328
Genome map
AA seq 391 aa AA seqDB search
MNEVVVVAAKRSAVGSFLGSLKSVGAREMGVYVLKDALNASSLKPSDVDSVILGNVLGAG
LGQNIARQIQLDAGIPNDKNAFSVNMVCGSSMKAIQLAHDSIMLGHDEVVVCGGVENMSA
APYLSFDMREGKRMGNANMIDSMIHDGLWDAFNDYHMGITADNVAQAYHISREEQDNFAL
QSQLKARAAINAGKFQEEITPIEIANKKGVVVFKEDEYPRDTTLESLAKLKPAFKKDGSV
TAGNSSGINDGASIIILCSAKKAQALGLKTMATIKGFGLGGCSPDIMGICPSIAIKNNLK
NVKMNLNDINLFELNEAFAAQSLAVLKELELNPNIVNVNGGAIAIGHPIGASGARILVTL
LHEMKKSGHGVGCASLCVGGGQGLSVVVEQK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtggttgtagtggcggcaaaacgaagcgctgtagggagttttttaggctct
ctaaagagcgtgggcgctagagaaatgggtgtttatgtgcttaaagatgctttgaatgcg
agctctcttaagcctagcgatgtggattccgtcattttaggcaatgttttaggcgccggt
ttgggtcaaaatatcgctaggcagatccaactagacgctggcatccctaatgacaaaaac
gcttttagcgtcaatatggtttgtggatcgtctatgaaagctatccagttagcgcatgac
agcatcatgcttgggcacgatgaggtggtggtgtgcggtggcgtggagaacatgagtgca
gcgccctatctgtcgtttgatatgcgagaggggaaaagaatggggaatgcgaacatgata
gattccatgatacatgatggattatgggatgcgttcaatgattaccacatggggatcacc
gctgataatgtcgctcaagcataccacataagccgagaagagcaagataatttcgcgctc
caatcgcaactcaaagcaagagccgccattaatgcggggaaattccaagaagaaatcacg
cctattgaaatagcgaataaaaaaggcgtggtggtttttaaagaagacgaataccctaga
gacacgacactagaatcccttgcaaagctcaaacccgctttcaaaaaagacggatcagta
acggcaggaaattcatcagggatcaatgatggcgcgagtattatcattttatgcagcgct
aaaaaagcgcaagcattggggttaaaaaccatggccactattaaggggtttggtttgggt
ggttgcagtccggatataatggggatatgccctagcatcgctattaaaaacaaccttaaa
aatgtcaaaatgaatctcaacgacatcaatctttttgagctcaatgaagcctttgccgcg
caaagcctagccgtgttaaaagagcttgagttaaaccccaatatcgtgaatgtgaatgga
ggcgcgatagccattggccaccctattggcgcgagcggcgctaggatcttagtaacttta
ttgcatgaaatgaagaaaagcggtcatggcgtgggctgcgcgtcattgtgtgtgggcggc
gggcaaggtctttctgtggtagttgaacaaaaataa

DBGET integrated database retrieval system