KEGG   Herbaspirillum sp. meg3: hmeg3_03820Help
Entry
hmeg3_03820       CDS       T05024                                 

Definition
(GenBank) haloacid dehalogenase type II
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
hee  Herbaspirillum sp. meg3
Pathway
hee00361  Chlorocyclohexane and chlorobenzene degradation
hee00625  Chloroalkane and chloroalkene degradation
hee01100  Metabolic pathways
hee01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hee00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    hmeg3_03820
   00361 Chlorocyclohexane and chlorobenzene degradation
    hmeg3_03820
Enzymes [BR:hee01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     hmeg3_03820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase
Motif
Other DBs
NCBI-ProteinID: ASU37510
UniProt: A0A223P646
Position
complement(824146..824811)
Genome map
AA seq 221 aa AA seqDB search
MILKPKFISFDCYGTLINFEMGPTARTLFADRVTESRMSAFLDSFRFYRLDEVLGAWKPF
FEVVENAIQRACQAHHVEYRAADARALYDAIPTWQPHPHVVETLEAIAPHIPLVILSNSM
IDLIPHSVAHLKAPFHAVYTAEHAQAYKPRARAFEYMFDQLGCGPEQMMHCSSSFRYDHM
TAADLGFMSKAWIDRGHEPNCDGYSVNRLTDFRQLPGLLGL
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgattctcaagccgaagttcatcagtttcgattgctacggaacgcttatcaactttgaa
atggggcccactgccagaacgctgtttgcagatcgcgtgacggagagtcggatgagcgcc
ttcctcgacagtttccgtttctatcgactggacgaggtactcggtgcctggaagccgttc
ttcgaggtcgtcgagaacgccatccaacgggcgtgccaggcccatcacgtggaatatcgt
gcggctgatgcgcgcgcactctacgacgccatacccacctggcagccccatccccacgtc
gtggagacactggaagcgattgctccccacatcccgctggtcattctctctaattcgatg
atcgatcttatcccgcacagcgttgcgcacctcaaggcgccgttccacgcggtctacacc
gctgagcacgcacaggcctacaagccgcgcgcccgggcattcgaatacatgttcgaccag
ctcggttgcggcccggaacagatgatgcactgctcatcgagcttccgttacgaccacatg
acggcggccgacctgggcttcatgagcaaagcctggatcgatcgcggccatgagccaaac
tgcgatggctatagtgtcaatcgcctgaccgacttccgccagcttcccggcttgctgggc
ctttga

DBGET integrated database retrieval system