KEGG   Herbaspirillum sp. meg3: hmeg3_06810Help
Entry
hmeg3_06810       CDS       T05024                                 

Definition
(GenBank) bifunctional glutamine synthetase adenylyltransferase/deadenyltransferase
  KO
K00982  [glutamine synthetase] adenylyltransferase / [glutamine synthetase]-adenylyl-L-tyrosine phosphorylase [EC:2.7.7.42 2.7.7.89]
Organism
hee  Herbaspirillum sp. meg3
Brite
KEGG Orthology (KO) [BR:hee00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    hmeg3_06810
Enzymes [BR:hee01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.42  [glutamine synthetase] adenylyltransferase
     hmeg3_06810
    2.7.7.89  [glutamine synthetase]-adenylyl-L-tyrosine phosphorylase
     hmeg3_06810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GlnE GlnD_UR_UTase DUF294 DUF294_C NTP_transf_2
Motif
Other DBs
NCBI-ProteinID: ASU38035
UniProt: A0A223P7F1
Position
complement(1502634..1505429)
Genome map
AA seq 931 aa AA seqDB search
MRTQLITRQFVTISLLDSSAASRFLTRWANANPARPGQLAEFSQLSLNRAAFERILQADL
AASASKAGTTVTGAAALNGPMRRLRNLTVCTLIERDLTGKADLAEVVRTMSEFADFAVQT
HLNALMQEMTALYGMPIGEETGNEQELIVLGMGKLGGGELNVSSDIDLIFVYPEDGDTRT
DAPEQRSLSNHEFFVRLGKKLIAALSEITEDGFTFRVDMALRPNGASGPLVASHNMVEEY
LIRQGREWERYAWTKARALTGKPDDIAALEAISRPFIYRRYLDFGSIDALRSMHGQIRAE
VTRQESLHPERSNNVKLGRGGIREVEFVSQVFQLIRGGRDPELRDRSTRTTLRTLADKGL
LEPEVVAQLLEAYTFLRNLEHRLQYLEDAQTHTLPPNEDDQKIIANMMGFADVAALLAAL
EEHRRIVALQFDTIFNDKQDNGNTDGGDGTKNGDNTCDLGDGESAESIAATLTSLGFDEV
DTATQRVLATLQSPRLQSLPEASRARLIALINAALPIIGAMPDKNLPTLRRLLDFFEAIA
RRAAYLALLTEYPHALTRLIRMIAASDWAAKYLTQHPILLDELLDDRNLKAPPDWPAFAQ
DCQRQLDIAPGDTERQMDILREVHHAQLFRLLAQDLEGDLSVEHLADHLSALADILVAAT
IQAVWQTIANRHRETPQFTVIAYGKLGGKELGYVSDLDVVFLYDDDDQEAPGLYAKLAQR
FITWMTSHTPAGTLFDIDIALRPDGASGLLVSSFATFEKYQRTSAWVWEHQALTRARYCA
GDSTIGNRFEALRKDLLRQERDPQKLTQEVLGMRLKLHQAHPNHTPLFDLKHDDGGMIDI
EFIVQFLVLRHAAQYEALTDDIGNIALLKLCGSLGLIDAALADEVANAYRLFRKLQHQIR
LRGEERARTTIERVQQESDAVKRLWTEVFGG
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacccaactcatcacccgacaatttgtgactatctcccttctcgacagcagtgca
gcctcccggttcctgacccgctgggcaaacgccaatccggcccgccccggacaactggcg
gaattctcccaattatccctgaaccgcgcggctttcgagcgcattttgcaagctgatctg
gcagcttccgcgtccaaagccggcacaaccgttacgggtgccgccgccttgaacggcccc
atgcgacgtctgcgcaatctgacggtctgtacgctgatcgaacgcgacctgaccggcaag
gcggatctggccgaggtggtgcgcaccatgagcgaattcgccgattttgccgtccagacc
catctcaacgccctgatgcaggaaatgactgccctctacggcatgcccatcggagaggaa
accggcaacgaacaggagctgatcgtgctcggcatgggcaagctgggcggcggagaactg
aacgtctcgtccgacatcgacctcatcttcgtctatccggaggatggggacacacgtacc
gatgcaccagagcaacgctcgctctccaatcacgagttctttgtccggctcggcaagaaa
ctcattgccgccctgtctgaaatcaccgaagacggtttcacctttcgcgtcgacatggcg
ctgcgacccaacggcgcttccggtccgttggtcgccagccacaacatggtggaagaatat
ctgattcgccagggccgggaatgggaacgctacgcctggaccaaggcacgcgcgctgaca
ggcaagcccgacgatatcgctgccctggaagccatcagccggcccttcatctaccggcgt
tatctggatttcggttcaatcgatgccctgcgctccatgcacggccaaatccgcgcagaa
gtcacgcgccaggaatcgctgcatccggaacgcagcaataacgtcaaactgggccgcggc
ggtatccgtgaagtggaatttgtcagccaggtgttccaactgatccgcggtggccgcgat
cctgaactgcgcgaccgttcaacccgcaccacgctgcgcacgctggccgacaaaggcttg
ctggagccggaggtcgtggcgcaattgctggaggcctataccttcctgcgcaatctggaa
caccgcttgcagtatcttgaagatgcgcagacgcataccctgccaccgaacgaagacgac
cagaagatcattgccaacatgatgggctttgccgacgtggcagctttgctggcggcgctg
gaagaacaccgtcgtatcgtcgccctgcagttcgacaccatcttcaacgacaagcaggac
aacggcaataccgacggcggcgatggcactaaaaacggtgacaacacctgcgatctcggc
gatggcgaaagcgccgaatcgatcgctgccacgctgacctcactgggcttcgacgaggtc
gacaccgctacccagcgcgtgctggcgacactgcaatcgccgcgcctgcaatccctgccg
gaagccagccgtgcgcgactgatcgcgctgatcaacgctgccctgccgattatcggcgcc
atgcctgacaaaaacttgccgaccttgcgccgcctgctcgatttcttcgaagcgattgcc
cgccgcgctgcttacctggcactgctgacggaatatcctcacgcgctgacacgcctgatc
cgcatgatcgccgccagcgactgggcagcaaaatacctgacgcagcatcccattctgctc
gacgaactgctggatgaccgcaacctgaaagcgcctcctgactggcccgcttttgcacaa
gattgccagcgccagcttgacatcgcgccgggcgacacagaacgccagatggacattctg
cgcgaggtgcaccatgcgcagttgttccgcctgctcgcgcaggatcttgaaggtgatctg
agcgtcgagcatctggccgatcatctgtccgcactggccgacattctggtcgcggccacc
attcaggcggtctggcaaaccatcgccaatcgccatcgcgaaacaccgcaattcaccgtc
atcgcttacggcaaactgggcggcaaggagctcggctatgtctccgaccttgacgtcgta
ttcctttacgacgacgacgatcaggaagcgcccggcctgtacgccaagctggcgcagcgc
ttcattacctggatgacctcgcacacgcccgcaggtacgctgttcgatatcgatatcgcc
ttgcgtccggacggtgccagcggcttgctggtgtcatccttcgccacatttgaaaagtac
cagcgcacttcggcctgggtatgggaacaccaggcactgacccgtgcacgctattgcgcc
ggcgacagcactatcggcaatcgttttgaagcattgcgcaaagacctgctgcgccaggaa
cgcgatccgcaaaagctgacgcaggaagtgctcggcatgcgcctcaagctgcatcaggcg
caccccaaccataccccgttgttcgatctgaaacatgacgacggcggcatgatcgatatt
gaattcatcgtgcagtttttagtgctgcgccatgcggcacagtacgaagcgctgaccgac
gacattggcaacatcgccttgctgaagctctgtggttcgctgggtctgatcgacgccgca
ttggcagatgaggttgccaacgcctatcgcttgttccgcaaactgcagcatcagatccgg
ctgcgcggtgaagaacgcgcccgcaccactatcgaacgcgtgcaacaagaaagcgatgcc
gtcaaacggctctggacggaagtgttcggcggatag

DBGET integrated database retrieval system