KEGG   Herbaspirillum sp. meg3: hmeg3_10440Help
Entry
hmeg3_10440       CDS       T05024                                 

Definition
(GenBank) amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
hee  Herbaspirillum sp. meg3
Pathway
hee00970  Aminoacyl-tRNA biosynthesis
hee01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hee00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    hmeg3_10440
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hee03029]
    hmeg3_10440
Enzymes [BR:hee01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     hmeg3_10440
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     hmeg3_10440
Mitochondrial biogenesis [BR:hee03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    hmeg3_10440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ASU38672
UniProt: A0A223P9D8
Position
2296924..2298267
Genome map
AA seq 447 aa AA seqDB search
MKTIRALAAELQSGQTTSVKLVEQALERIASYRGQGGAAYISVDTDRALAAARASDAARA
AGNVPSLLAGLPVSIKDLFDVQGEVTAAGSKALASKPAAKNDASAVAHLRHAGAILLGRT
NMSEFAFSGLGLNPHYGTPRNPLDVERVSGGSTSGGAVTVALDMAVAALGTDTGGSIRIP
SAFCGLTGFKPTADRVSLQGAVPLSTTLDSAGPLSRSVDCCAIVDAILSGENLETDAVPL
AGLRFGVTDDFVGDGMDATVRAAFDAALSRLQSAGALIQRFSFPELKELPLINAGGGFSA
AESWAWHRKLLESSADQYDQRVAVRIRRGAQQTAADYIDLLEARRRIIAQAARRLSVFDA
WLMPTVPVVPPMVQALQDNDETFFATNGLVLRNPSVINFLDGCALNLPCPSEGGLPVGIS
ICGQYGNDARVLAIGRTVEAVLSGKQS
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaagactatcagagcactcgctgcagaattgcagtctgggcagacaacgagcgtcaaa
ttggtagagcaggcgctggagcgtatcgcttcgtatcgcgggcagggcggtgcggcttat
atcagtgtcgacactgatcgggcgttggctgcggcgcgcgccagcgatgccgcgcgtgct
gccggcaacgtgccttcgttgttggccggtttgccggtctcgatcaaggatttgtttgac
gtgcaaggtgaagtgactgcagccggttcgaaagcactcgctagcaagccggccgcaaaa
aatgatgcgtctgcagtggcgcatctgcggcatgcgggcgcgattttgctcggtcgtacc
aatatgagcgagtttgccttctccggtctcggcctgaatccgcactacggtacgccgcgc
aatcctttggatgtggagcgggtgagtggtggttcgacttccggcggcgccgtgaccgta
gcgctggacatggctgtagcggcgttgggtacggataccggcggctcgatccgtatccct
tccgcgttttgcggattgaccggcttcaagccaacagcagatcgtgtgagtttgcagggg
gcggtaccgttgtcgaccacgttggactctgccgggcccctgtcgcgcagcgtggattgc
tgtgccatcgtcgatgccattttgtccggcgaaaatcttgaaacggatgccgtgcccctt
gcaggcctgcgattcggtgtaaccgatgattttgtcggtgatggcatggacgccaccgtg
cgcgctgcttttgatgcggcgttgtcgcgcttgcaaagcgcaggtgcgttgattcaacgc
ttttcatttcctgaactgaaagaattgccgctgatcaatgctggcggtggtttcagtgca
gcagagtcgtgggcatggcatcgcaagctactggaaagctctgcggatcagtacgatcag
cgtgtggcggtgcgcatccgtcgtggcgctcagcagactgcggccgattatattgatctt
cttgaggcgcgtcggcgcatcattgcgcaggccgcgcgtcgcttgtcggtattcgatgca
tggttgatgccgaccgtcccggtggtgccgccaatggtgcaagctttgcaagacaatgat
gaaactttctttgccaccaacggcctggtattgcgcaatccgagtgtgatcaattttctg
gacggctgtgcattgaacttgccgtgcccgtccgaaggaggattgccggtcggcatcagc
atttgcggccagtatggcaacgacgcacgcgtgctggcaatcggccgcactgtggaagca
gttttgtccggcaagcagagctga

DBGET integrated database retrieval system