KEGG   Herbaspirillum sp. meg3: hmeg3_22370Help
Entry
hmeg3_22370       CDS       T05024                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hee  Herbaspirillum sp. meg3
Pathway
hee00071  Fatty acid degradation
hee00072  Synthesis and degradation of ketone bodies
hee00280  Valine, leucine and isoleucine degradation
hee00310  Lysine degradation
hee00362  Benzoate degradation
hee00380  Tryptophan metabolism
hee00620  Pyruvate metabolism
hee00630  Glyoxylate and dicarboxylate metabolism
hee00640  Propanoate metabolism
hee00650  Butanoate metabolism
hee00900  Terpenoid backbone biosynthesis
hee01100  Metabolic pathways
hee01110  Biosynthesis of secondary metabolites
hee01120  Microbial metabolism in diverse environments
hee01130  Biosynthesis of antibiotics
hee01200  Carbon metabolism
hee01212  Fatty acid metabolism
hee02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hee00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    hmeg3_22370
   00630 Glyoxylate and dicarboxylate metabolism
    hmeg3_22370
   00640 Propanoate metabolism
    hmeg3_22370
   00650 Butanoate metabolism
    hmeg3_22370
  09103 Lipid metabolism
   00071 Fatty acid degradation
    hmeg3_22370
   00072 Synthesis and degradation of ketone bodies
    hmeg3_22370
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    hmeg3_22370
   00310 Lysine degradation
    hmeg3_22370
   00380 Tryptophan metabolism
    hmeg3_22370
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    hmeg3_22370
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    hmeg3_22370
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    hmeg3_22370
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hee04147]
    hmeg3_22370
Enzymes [BR:hee01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     hmeg3_22370
Exosome [BR:hee04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   hmeg3_22370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ASU40773
UniProt: A0A223PFA4
Position
complement(4975092..4976267)
Genome map
AA seq 391 aa AA seqDB search
MDDVVIVAAQRTAVGKFGGSLSKIAASDLGAQVIKALLAKTGIKPESISEVILGQVLTAG
VGQNPARQAVIRSGLPDMVPAFVVGKVCGSGLKAVQLAAQAIKCGDAQIVIAGGQENMSA
SPHVLNNSRDGFRMGDAKLTDTMIVDGLWDVYNQYHMGITAENVAKKYDISRKEQDEFAA
ASQNKAEAAQKAGKFKDEIIPIEIKSKKETILFDTDEFIKPGVTAEALGTLRPAFDKEGT
VTAGNASGINDGAAAVVLMSAKLAAELGLPVLAKIKSYSSAGLDPSIMGMGPVPASQLTL
KKAGWTPQDLDLMEINEAFAAQAIAVNKQMGWDTSKINVNGGAIAIGHPIGASGCRVLVT
LLHEMVRRDAKRGLASLCIGGGMGVALAVER
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggatgacgtcgttattgttgcagcacagagaacagcagtcggtaagttcggcggttcc
ttgtcgaaaattgccgcctccgatctgggcgcgcaagtcatcaaagccttgctggcgaag
acaggcatcaagcctgaaagcatcagcgaagtcatcctcggccaggtgctgacagccggc
gtcggccagaacccggcgcgccaggcggtgattcgctcgggcttgcctgatatggtgccg
gccttcgtggtcggcaaggtgtgcggcagcggcctgaaagcggtgcaattggcagcgcag
gcgatcaagtgtggcgacgcacagatcgtgattgccggcggccaggaaaacatgagcgcc
tcgccacacgtactgaacaattcgcgcgacggtttccgcatgggcgacgccaagctgacc
gacaccatgatcgtcgacggcctgtgggacgtctataaccaataccacatgggtatcacg
gccgaaaacgtcgccaagaaatacgatatctcccgcaaggagcaggacgagtttgccgcc
gcttcgcaaaacaaggccgaagctgcgcaaaaggcaggcaagttcaaggatgaaatcatc
cctatcgaaatcaagagcaaaaaagaaaccatcctgttcgacaccgatgaattcatcaag
cctggcgtcaccgccgaagcgctgggtaccttgcgtcctgctttcgacaaggaaggcact
gtcactgccggcaacgcgtcgggcatcaatgacggtgctgccgccgtagtcctgatgtcg
gccaaactggcggcggaactcggcttgccggtgctggccaagatcaagtcgtattcgtcg
gccggtctggatccaagcatcatgggcatgggcccggtgccggcgtcgcaactgaccttg
aagaaggccggctggacaccacaagacctggatctgatggaaatcaacgaagcctttgcc
gcgcaagcgattgccgtcaacaagcaaatgggttgggacaccagcaaaatcaacgtcaat
ggcggcgcgattgcgatcggtcacccgatcggcgcgtcaggctgccgcgtgctggtcacg
ctgttgcacgaaatggttcgccgtgacgccaagcgcggtctggccagcttgtgtatcggc
ggcggcatgggtgtggcgctggcagtcgagcgctga

DBGET integrated database retrieval system