KEGG   Helicobacter pylori F16: HPF16_0283Help
Entry
HPF16_0283        CDS       T01910                                 

Definition
(GenBank) hypothetical protein
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hef  Helicobacter pylori F16
Pathway
hef00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hef01100  Metabolic pathways
hef01110  Biosynthesis of secondary metabolites
hef01130  Biosynthesis of antibiotics
hef01230  Biosynthesis of amino acids
Module
hef_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hef00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPF16_0283
Enzymes [BR:hef01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HPF16_0283
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: BAJ54880
UniProt: E6NCM0
Position
290517..291077
Genome map
AA seq 186 aa AA seqDB search
MQEIGILKNLQKSLALKEGMLSYEMLGKSLSYNPYLPRVIPQIKDCVFVTPDEVLGKLLE
ENTRTECVVVNFKGLYEIGAPSVFDLEVLGLLRRHASSLIVHQDLFISHYQLLESLVQGS
DGVILDEELLKEDLKGMAEFAWRLGLSVFVETHKPDYTHLKDLGVLGVLEKVPHSQQNRK
KIVFLD
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaatagggattttaaaaaatttacaaaaaagcttggccttaaaagagggcatg
ctttcttatgaaatgctgggtaaaagcctgtcgtataacccttacttgcctagagtcatt
cctcaaattaaagattgtgtttttgtaacccctgatgaggttttaggaaagcttttggaa
gaaaacacccgcacagaatgcgtcgttgtcaatttcaaaggattatacgaaataggcgcg
ccaagcgtgtttgatttagaagttttagggttattgcgccgccatgcgagttctttgatt
gtccatcaggatcttttcatcagccattaccagcttttagaatcgcttgttcaaggctct
gatggggtcattttagacgaagagcttttgaaagaagatttaaagggcatggcagaattc
gcttggcgtttgggtttaagcgtgtttgtagaaacccacaagccagactatacccattta
aaagatttaggggttttaggcgtgctagaaaaagtcccccattctcaacaaaatcgaaaa
aaaatagtttttttagattga

DBGET integrated database retrieval system