KEGG   Helicobacter pylori F16: HPF16_1054Help
Entry
HPF16_1054        CDS       T01910                                 

Gene name
porB
Definition
(GenBank) pyruvate ferredoxin oxidoreductase, beta subunit
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
hef  Helicobacter pylori F16
Pathway
hef00010  Glycolysis / Gluconeogenesis
hef00020  Citrate cycle (TCA cycle)
hef00620  Pyruvate metabolism
hef00640  Propanoate metabolism
hef00650  Butanoate metabolism
hef00680  Methane metabolism
hef01100  Metabolic pathways
hef01120  Microbial metabolism in diverse environments
hef01130  Biosynthesis of antibiotics
hef01200  Carbon metabolism
Module
hef_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hef00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPF16_1054 (porB)
   00020 Citrate cycle (TCA cycle)
    HPF16_1054 (porB)
   00620 Pyruvate metabolism
    HPF16_1054 (porB)
   00640 Propanoate metabolism
    HPF16_1054 (porB)
   00650 Butanoate metabolism
    HPF16_1054 (porB)
  Energy metabolism
   00680 Methane metabolism
    HPF16_1054 (porB)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPF16_1054 (porB)
Enzymes [BR:hef01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPF16_1054 (porB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C Myb_DNA-bind_4
Motif
Other DBs
NCBI-ProteinID: BAJ55651
UniProt: E6NEU1
Position
1111861..1112805
Genome map
AA seq 314 aa AA seqDB search
MVKEVKTLKGFSQSAEKFQGSHLLCPGCGHGIIVREVLNAVDGPIVLGNSTGCLEVCSAV
YPHTSWDVPWIHIGFENGSTAISGVEAMYKALVNKGRYQGQKPKFVAFGGDGASYDIGLQ
FISGCMERGHDMTYICLDNENYANTGGQRSGSTPLGASTSTTPSGSVSFGKKEKKKDIVN
IMASHGVPYVAQLSPNKWKDMNKKIKTALDTEGPCFINALSPCTTEWKFESNKTIELADM
AVDSLMFPLFEIFNGRELKITYRPRNIIPVRDYLGAQKRFKHLFKKENEHIIEELQKDVN
ERWEYLQRREEAKV
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaagaagtcaaaacactcaaaggttttagccaaagcgctgaaaaattccaaggc
tcgcacttgctttgtccgggttgcgggcatggcattatcgtgcgcgaagttttaaacgct
gtagatgggcctattgttttaggcaattctaccggttgtttagaggtatgctcggcggtg
tatccgcacacttcatgggatgtgccttggattcatattggttttgaaaatggctctacg
gcgatttcaggggtggaagcgatgtataaagcgctagtgaataagggccgctatcaaggt
caaaaaccaaaattcgtggcgtttgggggcgatggggccagttatgatattggtctccaa
ttcatcagcggttgcatggaaagagggcatgacatgacttacatttgcctggataatgaa
aactatgccaacaccggcggtcaaagaagcggctctacgccattaggggctagcacttct
accacgccatcaggatcggttagctttggtaaaaaagaaaagaaaaaagacatcgtcaat
atcatggcaagccatggggttccttatgtggcgcagctctcgcctaacaaatggaaagac
atgaacaaaaagattaaaaccgcgctagacactgaagggccttgcttcatcaacgctctt
agcccatgcacgactgaatggaaatttgaatccaataaaaccattgaattagcggatatg
gctgtggatagcttgatgttccccctatttgaaatctttaatggcagggaattgaaaatc
acttaccgcccaagaaatatcattcctgtaagggattatttaggggctcaaaagcgcttc
aaacaccttttcaaaaaggaaaacgaacacattattgaagaattgcaaaaagatgtgaat
gagcgttgggaatacttgcaacgcagagaagaagctaaagtataa

DBGET integrated database retrieval system