KEGG   Helicobacter pylori F16: HPF16_1245Help
Entry
HPF16_1245        CDS       T01910                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
hef  Helicobacter pylori F16
Pathway
hef03010  Ribosome
Brite
KEGG Orthology (KO) [BR:hef00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    HPF16_1245 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hef03011]
    HPF16_1245 (rplV)
Ribosome [BR:hef03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    HPF16_1245 (rplV)
  Bacteria
    HPF16_1245 (rplV)
  Archaea
    HPF16_1245 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 ptaRNA1_toxin
Motif
Other DBs
NCBI-ProteinID: BAJ55842
UniProt: E6NFD2
Position
complement(1310676..1311044)
Genome map
AA seq 122 aa AA seqDB search
MSKALLRFVRLSPTKARLIARQIQGMNAELAIASLEFTPNKAARVLSKVVASAVANGSLD
AKSALIVSCRVDAGPVLRRSIPRAKGRATAIRKPTSHVFVEVVEGKEMKSSKSHKKNQAE
GK
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagcgttattaagatttgtgcggttatctcctactaaagccagattgattgca
agacagattcaaggcatgaacgctgaattagcgattgctagtttggaatttacgcccaat
aaagcggctagagtgctttcaaaagtggtggcttctgcggtcgctaacggctctttagac
gccaagagcgctctgattgtttcttgcagagtggatgctggccctgtgcttaggcgctcc
attccaagggctaaaggcagagccacagccattagaaagccaacatctcatgtattcgta
gaagtagtagaagggaaagaaatgaaatcttctaaaagccataaaaaaaatcaagcagaa
ggtaagtag

DBGET integrated database retrieval system