KEGG   Helicobacter pylori F16: HPF16_1373Help
Entry
HPF16_1373        CDS       T01910                                 

Gene name
ubiD
Definition
(GenBank) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
hef  Helicobacter pylori F16
Pathway
hef00130  Ubiquinone and other terpenoid-quinone biosynthesis
hef00627  Aminobenzoate degradation
hef01100  Metabolic pathways
hef01110  Biosynthesis of secondary metabolites
hef01120  Microbial metabolism in diverse environments
hef01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:hef00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    HPF16_1373 (ubiD)
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    HPF16_1373 (ubiD)
Enzymes [BR:hef01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     HPF16_1373 (ubiD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: BAJ55970
UniProt: E6NFR0
Position
complement(1436709..1437272)
Genome map
AA seq 187 aa AA seqDB search
MKLVLGISGASGIPLALRFLEKLPKEIEVFVVASKNAHVVALEESNINLKNAMKDLRPSA
TFFNEQDIHASIASGSYGIHKMAIIPASMDMVAKIAHGFGGDLISRSASVMLKEKRPLLI
APREMPLSAIMLENLLKLARSNAIIAPPMMTYYTQSKTLEAMQDFLVGKWFDSLGIENDL
YPRWGMN
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagttttaggcatcagtggagcaagcgggatacccctagccttgcggttttta
gaaaaattacccaaagaaattgaagtttttgttgtggcgtctaaaaacgcgcatgtcgtg
gcgttagaagaatctaatatcaaccttaaaaacgccatgaaagatttacggcctagtgct
actttttttaacgagcaagacatccatgcgagcatcgcctcagggagttatggtatccat
aaaatggcgatcattccagcgagcatggacatggtggctaaaatcgcgcatggctttggg
ggggatttgatctctaggagcgcgtctgtgatgcttaaagaaaagcgccccttactcatt
gcccccagagaaatgcccctaagcgctatcatgctagaaaatttgctcaaactcgcccgc
tctaatgcaatcattgcgccgccgatgatgacttattacacccagagcaagactttagaa
gcgatgcaagattttttagtggggaagtggtttgacagcttagggatagaaaacgactta
tacccacgatggggaatgaactga

DBGET integrated database retrieval system