KEGG   Helicobacter pylori F16: HPF16_1388Help
Entry
HPF16_1388        CDS       T01910                                 

Definition
(GenBank) phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
hef  Helicobacter pylori F16
Brite
KEGG Orthology (KO) [BR:hef00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    HPF16_1388
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 RnlB_antitoxin NnrS DUF1240
Motif
Other DBs
NCBI-ProteinID: BAJ55985
UniProt: E6NFS5
Position
complement(1452860..1454461)
Genome map
AA seq 533 aa AA seqDB search
MEIKNIKEFEKASKKLQKDTLKIALALLFLIGAALLALIFGQANSKGLLLIFAAVIGGYM
AMNIGANDVSNNVGPAVGSKAISMGGAILIAGICEMLGAIIAGGEVVSTIKGRIVSPESI
NDAHVFINVMLASLLSGALWLHVATLIGAPVSTSHSVVGGIMGAGMAAAGMSAVNWHFLS
GIVASWVVSPLMGALIAMFFLMLIKKTIAYKEDKKSAALKVVPYLVALMSLTFSWYLIVK
VLKRLYALNFEIQLACGCILALLIFILFKRFVLKKAPQLENSHESINELFNIPLIFAAAL
LSFAHGANDVANAIGPLAAISQTLEDANSPMGNTLSSVPLWIMVVGAAGIALGLSLYGPK
LIKTVGSEITELDKMQAFCIALSAVITVLLASQLGLPVSSTHIVVGAVFGVGFLRERLRE
QSRRRFARIRDNIVAAHFGEDLEEIEGFLERFDKANLKEKSLMLESLKKSKNTAIALELK
KKEKKSLKKVYKEEVIKRSILKKIVTAWLVTVPVSALLGALLFVALGFIEKYF
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggaaattaaaaacatcaaggagtttgaaaaagcttctaaaaaactccaaaaagacact
ttaaagatcgctctcgctcttttgtttctcattggtgctgctttgctcgctcttattttt
gggcaggctaattctaagggattgttgctcatctttgcggctgtgattggggggtatatg
gcgatgaatattggtgcgaatgatgtgtctaataatgtcggccctgccgtaggctctaaa
gccattagcatgggcggggcgattttgattgctgggatttgtgaaatgcttggagcgatc
attgctgggggggaagtggtttctacgattaaaggccgtatcgtttcgcctgaatccatt
aatgatgcgcatgttttcattaatgtcatgttggctagccttttgagtggggcgttgtgg
ttgcatgtagcgactttaataggcgctcccgtttccacttcacactctgtggtggggggg
attatgggggctggaatggcagcagctggaatgtctgctgtcaattggcattttttatca
ggtattgtggctagttgggtggtttcgcctttaatgggggctttgatagccatgtttttt
ttaatgctcattaaaaagactatcgcttataaagaagataaaaagagtgcggctttaaag
gtcgtgccttacttggtggcgttgatgagtttaacatttagctggtatttgatcgttaag
gttttaaaacgcctctatgcactgaattttgaaatccagctggcttgcggctgtatcctt
gcgcttttaatctttatcctttttaaaaggtttgtgttaaaaaaagccccgcaattagaa
aacagccatgaaagcattaatgagcttttcaatatccctttgatttttgccgctgcgctt
ttaagctttgcgcatggggctaatgatgtggctaacgctataggcccactagcggccatc
agtcaaactttagaagatgcaaatagccctatggggaatactttaagctctgtgccgttg
tggattatggtagtaggggcagctgggattgctttaggcttgagtttgtatgggccaaag
ctcattaaaacggtggggtctgaaatcacagaattagacaaaatgcaagctttttgcatc
gcgctttctgcagtcatcaccgtgcttttagcctctcaattaggcttgcctgtgagctct
acgcatattgtggtgggcgcggtgtttggggtgggctttttaagggagcgcttaagagag
caatcaagaaggcgttttgctaggatcagagataacattgtagcggcgcactttggggaa
gatttagaagaaattgaaggctttttagagcgctttgataaagccaatttgaaagaaaaa
tcgctcatgctagagagcttgaaaaaaagcaagaacaccgccatcgctttggaattgaaa
aagaaagaaaaaaagtcgcttaaaaaagtgtataaagaagaggtgatcaaacgctccatt
ttaaaaaagattgttaccgcttggcttgtaaccgtgccggtttctgcgcttttaggggcg
cttctttttgtggctcttggttttatagaaaagtatttctag

DBGET integrated database retrieval system