KEGG   Helicobacter pylori Gambia94/24: HPGAM_01645Help
Entry
HPGAM_01645       CDS       T01917                                 

Gene name
amiE
Definition
(GenBank) acylamide amidohydrolase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
heg  Helicobacter pylori Gambia94/24
Pathway
heg00330  Arginine and proline metabolism
heg00360  Phenylalanine metabolism
heg00380  Tryptophan metabolism
heg00627  Aminobenzoate degradation
heg00643  Styrene degradation
heg01100  Metabolic pathways
heg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:heg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    HPGAM_01645 (amiE)
   00360 Phenylalanine metabolism
    HPGAM_01645 (amiE)
   00380 Tryptophan metabolism
    HPGAM_01645 (amiE)
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    HPGAM_01645 (amiE)
   00643 Styrene degradation
    HPGAM_01645 (amiE)
Enzymes [BR:heg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     HPGAM_01645 (amiE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase Cdc13_OB4_dimer
Motif
Other DBs
NCBI-ProteinID: ADU81175
UniProt: E8QKN1
Position
327157..328176
Genome map
AA seq 339 aa AA seqDB search
MRHGDISSSPDTVGVAVVNYKMPRLHTKEEVLENCRNIAKVIGGVKQGLPGLDLIIFPEY
STHGIMYDRQEMFDTAASVPGEETAILAEACKKNKVWGVFSLTGEKHEQAKKNPYNTLIL
VNDKGEIVQKYRKILPWCPIECWYPGDKTYVVDGPKGLKVSLIICDDGNYPEIWRDCAMR
GAELIVRCQGYMYPAKEQQIAIVKAMAWANQCYVAVANATGFDGVYSYFGHSSIIGFDGH
TLGECGEEENGLQYAQLSVQQIRDARKYDQSQNQLFKLLHRGYSGVFASGDGDKGVAECP
FEFYKTWVNDPKKAQENVEKFTRPSVGVAACPVGDLPTK
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgagacatggagatattagtagcagccccgatactgtgggcgtagcggtagttaattat
aagatgcctagactccacactaaagaagaggtgttggaaaattgtcgcaatatcgctaag
gtgattggtggggtcaaacagggtttgcctgggttggatctgattattttccccgaatac
agcacgcatgggatcatgtatgacagacaagagatgtttgacaccgctgcgagcgttcct
ggagaagaaaccgcaatccttgctgaggcttgtaaaaagaacaaggtttggggagtgttc
tctttaactggagaaaaacatgagcaagctaaaaagaatccctataacactttgattctt
gtcaatgataagggtgagatcgtgcaaaaataccgcaaaatcttgccttggtgccctatt
gaatgttggtatcctggggataaaacctatgtggttgatgggcctaagggcttgaaagtt
tctttgattatctgcgatgatgggaactaccctgaaatttggcgcgattgtgcgatgcgt
ggggcagagcttattgtgcgctgtcaaggttacatgtatccggctaaggagcaacaaatt
gcgatagtgaaagccatggcgtgggctaatcaatgttatgtagcggtagcgaatgcgacc
ggctttgatggggtgtattcctatttcgggcattctagcattattggttttgacgggcat
actctgggcgaatgcggggaagaagaaaatggtcttcaatacgctcaactttctgtgcaa
caaatccgtgatgcgaggaaatacgaccaaagccaaaaccaactcttcaaactcttacac
agaggctatagtggggtttttgctagtggcgatggggataagggtgtggcggaatgccct
tttgagttctataaaacttgggttaatgaccctaaaaaagctcaagaaaatgtagaaaaa
ttcactcgcccaagcgtgggcgtggccgcttgtcctgtaggcgatttgcccacgaaataa

DBGET integrated database retrieval system