KEGG   Helicobacter pylori Gambia94/24: HPGAM_05340Help
Entry
HPGAM_05340       CDS       T01917                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
heg  Helicobacter pylori Gambia94/24
Pathway
heg00450  Selenocompound metabolism
heg00970  Aminoacyl-tRNA biosynthesis
heg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:heg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    HPGAM_05340
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    HPGAM_05340
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:heg01007]
    HPGAM_05340
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:heg03016]
    HPGAM_05340
Enzymes [BR:heg01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     HPGAM_05340
Amino acid related enzymes [BR:heg01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   HPGAM_05340
Transfer RNA biogenesis [BR:heg03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    HPGAM_05340
 Prokaryotic type
   Other AARSs
    HPGAM_05340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e SAC3_GANP
Motif
Other DBs
NCBI-ProteinID: ADU81859
UniProt: E8QIB2
Position
complement(1083161..1085113)
Genome map
AA seq 650 aa AA seqDB search
MQKSLITTPIYYVNDIPHIGHAYTTLIADTLKKYYTLQGEEVFFLTGTDEHGQKIEQSAR
LRNQSPKAYADSISAIFKNQWDFFNLDYDGFIRTTDSEHQKCVQNAFEIMFEKGDIYKGT
YSGYYCVSCESYCAISKADNTNDKVLCPDCLRETTLLEEESYFFKLSAYEKPLLDFYAKN
PEAILPIYRKNEVTSFIEQGLLDLSITRTSFEWGIPLPKKMNDPKHVVYVWLDALLNYAS
ALGYLNGLDNKMAHFERARHIVGKDILRFHAIYWPAFLMSLNLPLFKQLCVHGWWTIEGV
KMSKSLGNVLDAQKLAMEYGIEELRYFLLREVPFGQDGDFSKKALVERINANLNNDLGNL
LNRLLGMAKKYFNYSLKSAKITAYYSKELEKAHQILDNANSFVPKMQLHKALEELFNIYD
FLNKLIAKEEPWVLHKNNESEKLEALLSLIANVLLQSSFLLYAFMPKSAMKLASAFRVEI
TPNNYERFFKTKNLQDMILQDTEPLFCKMEKVEKASPEKAPLKENQEKEKKDEKEKAPPT
QENYISIEDFKKVEIKVGLIKEAQRIEKSNKLLRLKVDLGENRLRQIISGIALDYEPESL
VGQMVCVVANLKPAKLMGEMSEGMILAVRDSDNLALISPTKEKIAGSLIS
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaatcactgatcacaacccccatttattatgtgaatgacatccctcatattggt
catgcttatacgactttgattgcggacactttaaagaagtattacacgctccaaggcgaa
gaagtcttttttttaaccggcaccgatgagcatgggcaaaagatcgaacaaagcgcgaga
ctaaggaatcaaagccctaaagcttacgccgatagcattagcgcgatttttaaaaaccag
tgggattttttcaatttggattatgatggttttatccgcaccacagacagcgagcatcaa
aaatgcgtgcaaaacgcctttgaaatcatgtttgaaaaaggggatatttataaaggcact
tatagcgggtattattgcgtgagctgtgagagttattgtgcgatttctaaagcggacaat
acgaatgataaagtcctatgccctgattgcttgagggagaccacgcttttagaagaagag
agttattttttcaaattgagcgcgtatgaaaagcctttattggatttttacgctaaaaac
cctgaagcgattttgcctatttatcgtaaaaatgaggtaacttcttttattgagcagggt
ttattggatctgtctatcacgcgcacgagctttgaatggggtattcctttgcctaaaaaa
atgaacgatcctaaacatgtggtgtatgtttggttagacgctttattgaattatgcgagt
gcgttagggtatttgaatggtttagacaataaaatggcgcattttgaacgcgctaggcat
attgtgggtaaggatattttacgcttccatgccatttattggccagcttttttgatgagt
ttgaacttgcccttattcaaacagctttgcgtacatgggtggtggacgatagagggcgtg
aaaatgagtaagagcttgggtaatgttttagacgctcaaaagctcgctatggagtatggg
attgaagaattacgctattttttattgcgtgaagtgccttttgggcaagatggggatttt
tctaaaaaagcgttagtagaacggatcaacgcgaatttgaataatgatttagggaatttg
ctgaatcgcttgctaggcatggctaaaaagtatttcaattattctctaaaaagcgccaaa
atcaccgcgtattattctaaagagctagaaaaagcgcatcaaattttagataacgctaat
tcttttgtgcctaaaatgcaattgcataaagctttagaggaattgtttaatatttatgat
tttttaaacaaactcatcgctaaagaagagccgtgggtcttgcataaaaacaacgaatca
gaaaaattagaagccttattgagcttgatcgcaaacgtgctgttgcaatcaagcttcttg
ctctatgcgttcatgccaaagagcgctatgaaattagcgagcgcttttcgtgtagaaatc
acgcccaataattacgaacgcttttttaaaaccaaaaatttacaagatatgattttacaa
gacaccgagcctttattttgtaaaatggaaaaagtggaaaaagcctcaccagaaaaagcc
ccactaaaagaaaatcaagaaaaagaaaaaaaagacgaaaaagaaaaagccccaccaaca
caagaaaattatatcagtattgaggatttcaagaaagtagagattaaagtggggcttatc
aaagaagctcaaaggattgaaaaatccaataaattactgcgcttaaaagtggatttaggc
gaaaatcgtttgaggcagatcatctcagggatcgctttggattatgagcctgaaagtttg
gtggggcaaatggtgtgcgtggtggccaatttaaaacccgccaagctcatgggcgaaatg
agtgagggcatgattttagcggtgcgagatagcgataatctagccttaatcagccctacc
aaagaaaaaatcgcaggaagtttgatcagttaa

DBGET integrated database retrieval system