KEGG   Helicobacter pylori Gambia94/24: HPGAM_05670Help
Entry
HPGAM_05670       CDS       T01917                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
heg  Helicobacter pylori Gambia94/24
Pathway
heg00010  Glycolysis / Gluconeogenesis
heg00052  Galactose metabolism
heg00500  Starch and sucrose metabolism
heg00520  Amino sugar and nucleotide sugar metabolism
heg00521  Streptomycin biosynthesis
heg01100  Metabolic pathways
heg01110  Biosynthesis of secondary metabolites
heg01120  Microbial metabolism in diverse environments
heg01130  Biosynthesis of antibiotics
heg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:heg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPGAM_05670 (glk)
   00052 Galactose metabolism
    HPGAM_05670 (glk)
   00500 Starch and sucrose metabolism
    HPGAM_05670 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    HPGAM_05670 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HPGAM_05670 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    HPGAM_05670 (glk)
Enzymes [BR:heg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HPGAM_05670 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: ADU81921
UniProt: E8QIH4
Position
1154626..1155636
Genome map
AA seq 336 aa AA seqDB search
MPKTETYPRLLADIGGTNARFGLEVAPRQIECVEVLPCEDFESLSDAVRFYLSKCKESLK
LHPIYGSFAVATPIMGDFVQMTNNHWTFSIETTRQCLNLKKLLVINDFVAQAYAISAMQE
NDLAQIGGIKCEINAPKAILGPGTGLGVSTLIQNSDGSLKVLPGEGGHVSFAPFDDLEIL
VWQYARSKFNHVSAERFLSGSGLVLIYEALSKRKGLEKVAKLSKTELTPQIISERALNGD
YPICRLTLDTFCSMLGTLAADVALTLGARGGVYLCGGIIPRFIDYFKTSPFRARFETKGR
MGAFLASIPVHVVMKKTPGLDGAGIALENYLLHDKI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaactgaaacttacccaagactattagccgatattggcggcacaaacgcgcgt
tttggtttggaagtcgccccacgacagattgaatgcgttgaagtcttgccatgcgaagat
tttgaaagcttgagcgatgcggtgcggttttacctctctaaatgcaaagaaagccttaaa
ctgcaccctatttatggctcttttgctgtggctacgcccatcatgggggattttgtccaa
atgacgaacaaccactggactttttctattgaaacgacacggcaatgtttgaatttaaaa
aaactgcttgtcatcaatgattttgtggcgcaagcctatgccattagcgcgatgcaagaa
aacgatctggcccaaataggcgggatcaagtgcgagattaacgcccctaaagcgatttta
gggcctggaaccgggcttggggtaagcactcttatccaaaacagcgatggctctttgaaa
gtcttgcccggtgaaggagggcatgtgagctttgccccttttgatgatttagaaatttta
gtgtggcaatacgcccgctctaaattcaaccatgtgagcgcggaaaggtttttgagcggg
agcggcttggtgctgatttatgaagctttatccaaacgaaaaggcttagaaaaagtggcg
aaattgagcaagactgaattaaccccacaaatcattagcgaacgcgccttgaatggggat
taccctatatgccgattgaccttggacactttttgctccatgcttggcacgctcgctgct
gatgtggctctcactttgggggctagagggggcgtgtatttgtgtggggggattatccca
cgattcattgattattttaaaacttcgccctttagagcgcgttttgaaacaaaagggcgc
atgggggcgtttctcgcttccatccctgtgcatgttgtgatgaaaaaaactcccggactt
gatggggcaggcattgcgttagaaaattatttactgcatgataagatatag

DBGET integrated database retrieval system