KEGG   Helicobacter pylori Gambia94/24: HPGAM_06620Help
Entry
HPGAM_06620       CDS       T01917                                 

Definition
(GenBank) bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
heg  Helicobacter pylori Gambia94/24
Pathway
heg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
heg01100  Metabolic pathways
heg01110  Biosynthesis of secondary metabolites
heg01130  Biosynthesis of antibiotics
heg01230  Biosynthesis of amino acids
Module
heg_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:heg00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPGAM_06620
Enzymes [BR:heg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HPGAM_06620
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     HPGAM_06620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ADU82107
UniProt: E8QJ10
Position
complement(1346702..1348060)
Genome map
AA seq 452 aa AA seqDB search
MPSVLENILKDKLLEVSALKKNHTLPANITPSDGDFKKALLEKKTSFILECKKASPSKGL
IRKDFDLLEITKTYEKFASCVSVLADSKHFLGSYENIKIVSQHSTKPILCKDFIIDAFQI
KLARVMGANAALLMLSVLDDKNYLELFNLAKSLNMSVLTEVSNQQEIKRLLKLQYDIIGI
NNRDLHTLKTDIFHTLKLRPLLPKDAIVISESGIYSHAQIKALAPYVNGFLVGSSLMKEK
DLKKACIKLILGENKVCGLTRIKDAKAVYKNHFIYGGLIFEKSSPRYIKPKEALKITKAV
KKLDFVGVFVKDKIKKIAKIAKKLDLKAVQLYGYSQKEIAQLKKVLPKTCAIWQVISVMN
AKDLAPKTKEASLILYDTKGDKMGGNGVSFDWEILKNAKTPFMLAGGLNLDNIQKALKVK
ALGLDFNSGLEISPGIKNKDKIRQLARILREY
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcctagcgtgttagaaaacatccttaaagacaaactcttagaagtctctgcactcaaa
aaaaatcacaccttgcccgcaaacataaccccaagcgacggggattttaaaaaagcgtta
ttggaaaaaaagacaagctttattttagagtgtaaaaaagcatcgccctccaaaggtttg
atcagaaaagattttgacttgttggaaataacgaaaacttatgaaaaatttgcctcttgt
gtttcggttttagccgattctaaacattttttaggctcttatgaaaacattaagatcgtt
tcgcagcattccaccaagcccattttgtgtaaagattttatcattgacgcttttcaaatc
aaactcgctagggttatgggggctaatgcggcgcttttgatgttaagcgtgttagatgat
aaaaattatttagagctttttaatctcgctaaatccttaaacatgagcgttttaactgaa
gtttccaaccagcaagaaatcaaacgcttgctcaaactccaatacgacattataggcatc
aataacagggatttgcacaccttgaaaaccgatatttttcacacgctcaaattacgcccc
ctgttgcctaaagacgcgatcgttatcagcgagtccggtatttattcgcatgcgcaaatc
aaagccctggccccttatgtgaatggctttttagtgggcagctctttaatgaaagaaaag
gatttgaagaaagcgtgtattaaattgattctaggcgaaaataaagtgtgcgggcttaca
agaatcaaagacgccaaagccgtttataaaaaccatttcatttatgggggtttgattttt
gaaaaatcttcgcccagatacatcaagcctaaagaagccttaaaaatcacaaaagcggtt
aaaaaactggattttgtgggcgtgtttgtgaaagataaaatcaaaaaaatcgcaaaaatc
gccaaaaagcttgatttaaaagcggtgcagctttatggctattcgcaaaaagaaatcgct
caattgaaaaaagtgctccctaaaacttgtgcgatttggcaagtaataagcgtgatgaac
gctaaagatttagcgcctaaaactaaagaggcctctctgattttatacgacactaagggg
gataaaatgggaggcaatggcgtgagttttgattgggaaattttaaaaaatgccaaaacg
cctttcatgctagctggggggcttaatttggataatattcaaaaagccttgaaagttaaa
gcgttgggtttggatttcaattcaggtttggaaataagccctgggattaaaaataaggat
aaaatcaggcaattagcccgaattttaagagagtattaa

DBGET integrated database retrieval system