KEGG   Helicobacter pylori Rif2: C730_03560Help
Entry
C730_03560        CDS       T02318                                 

Definition
(GenBank) acetyl coenzyme A acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hei  Helicobacter pylori Rif2
Pathway
hei00071  Fatty acid degradation
hei00072  Synthesis and degradation of ketone bodies
hei00280  Valine, leucine and isoleucine degradation
hei00310  Lysine degradation
hei00362  Benzoate degradation
hei00380  Tryptophan metabolism
hei00620  Pyruvate metabolism
hei00630  Glyoxylate and dicarboxylate metabolism
hei00640  Propanoate metabolism
hei00650  Butanoate metabolism
hei00900  Terpenoid backbone biosynthesis
hei01100  Metabolic pathways
hei01110  Biosynthesis of secondary metabolites
hei01120  Microbial metabolism in diverse environments
hei01130  Biosynthesis of antibiotics
hei01200  Carbon metabolism
hei01212  Fatty acid metabolism
hei02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hei00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    C730_03560
   00630 Glyoxylate and dicarboxylate metabolism
    C730_03560
   00640 Propanoate metabolism
    C730_03560
   00650 Butanoate metabolism
    C730_03560
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C730_03560
   00072 Synthesis and degradation of ketone bodies
    C730_03560
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C730_03560
   00310 Lysine degradation
    C730_03560
   00380 Tryptophan metabolism
    C730_03560
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    C730_03560
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C730_03560
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    C730_03560
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hei04147]
    C730_03560
Enzymes [BR:hei01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     C730_03560
Exosome [BR:hei04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   C730_03560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AFV45094
Position
740569..741744
Genome map
AA seq 391 aa AA seqDB search
MNEVVVVAAKRSAVGSFLGSLKSVGAREMGVSVLKDALNASGLKPSDVDSVILGNVLGAG
LGQNIARQIQLDAGIPNDKNAFSVNMVCGSSMKAIQLAHDSIMLGRDEMVVCGGVENMSA
APYLSFDMRDGKRMGNANMIDSMIHDGLWDAFNNYHMGITADNVAQAYHISREDQDNFAL
QSQLKARAAINAGKFQEEITPIEIANKKGVVVFKEDEYPRETTLESLAKLKPAFKKDGSV
TAGNSSGINDGASIIILCSTKKAQTLGLKAMATIKGFGLGGCSPDIMGICPSIAIKNNLK
NVKMNLNDIHLFELNEAFAAQSLAVLKELELNPNIVNVNGGAIAIGHPIGASGARILVTL
LHEMKRSGHGVGCASLCVGGGQGLSVVVEQK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtggttgtagtggcggcaaaacgaagcgctgtagggagttttttaggctct
ctaaagagcgtgggcgctagagaaatgggtgttagcgtgcttaaagacgctttgaatgcg
agcggccttaagcctagcgatgtggattctgtcattttaggcaatgttttaggcgctggt
ttgggtcaaaatatcgccaggcagatccaactagacgccggcatccctaatgacaaaaac
gcttttagcgtcaatatggtttgcggatcgtctatgaaagctatccagttagcgcatgac
agcatcatgcttgggcgcgatgagatggtggtgtgcggtggcgtggagaacatgagcgca
gcaccctatttgtcgtttgacatgcgagatgggaaaagaatggggaatgcgaacatgata
gattccatgatacatgatggattgtgggatgcgttcaataattaccacatggggatcacc
gctgataatgtcgctcaagcataccacataagccgagaagatcaagataatttcgcgctc
cagtcgcaactcaaagcaagagccgccattaatgcagggaaattccaagaagaaatcacg
cctattgaaatagcgaataaaaaaggcgtggtggtttttaaagaagacgaataccctaga
gaaacgacgctagaatcccttgcaaagctcaaacccgctttcaaaaaagacggatcggta
acggcgggaaattcatcagggatcaatgatggcgcgagtattatcattttatgcagcact
aaaaaagcgcaaacattggggttaaaagccatggcgactatcaaggggtttggtttgggt
ggttgcagtccggatataatgggtatatgccctagcatcgcgattaaaaacaaccttaaa
aatgtcaaaatgaatctcaatgacatccatctttttgaactcaatgaagcctttgccgcg
caaagcctagccgtgttaaaagagcttgaattaaaccccaatatcgtgaatgtgaatgga
ggcgcgatagcgattggccaccctattggcgcgagcggtgctaggatattggtaacttta
ttgcatgaaatgaaaaggagcgggcatggcgtgggttgtgcgtcattgtgtgtgggcggc
gggcaaggtctttctgtggtagttgaacaaaaataa

DBGET integrated database retrieval system