KEGG   Helicobacter pylori Rif2: C730_05680Help
Entry
C730_05680        CDS       T02318                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
hei  Helicobacter pylori Rif2
Pathway
hei00030  Pentose phosphate pathway
hei00480  Glutathione metabolism
hei01100  Metabolic pathways
hei01110  Biosynthesis of secondary metabolites
hei01120  Microbial metabolism in diverse environments
hei01130  Biosynthesis of antibiotics
hei01200  Carbon metabolism
Module
hei_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:hei00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    C730_05680
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    C730_05680
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hei04147]
    C730_05680
Enzymes [BR:hei01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     C730_05680
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     C730_05680
Exosome [BR:hei04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   C730_05680
  Exosomal proteins of colorectal cancer cells
   C730_05680
  Exosomal proteins of bladder cancer cells
   C730_05680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: AFV45499
Position
1162214..1163491
Genome map
AA seq 425 aa AA seqDB search
MLDFDLVLFGATGDLAMRKLFVSLYEIYTHYGFKNDSRIIASGRKELSNEEFLTLLCEKT
QLHSREKGREFLAHISYLCVRLDNPKDFEELSKIATKNKPLIFYFSISPSFFATTAQHLA
KNALNHANTRLILEKPLGHDLKTCKEIFQSISVFFKEEQIFRIDHYLGKKGVQNILELRL
NNPILNILWDQISAVEICVYETLGVEERGEFYDKIGALRDMVQNHLLQVLSLIATDLPNN
LKDLRKEKIKVLKTLQPPKDFKKQVIRAQYQGYRDENKVHKESQTETFVAIKAFLDTPKF
KGVPFYLKHAKKMPHNQASVKIHFNAVNTLEFFLSQDKITLTLKDHQNPLILETHNKQEF
LRPYAKLLYDAIQNNHNNFAHQLELEASWVFIDTLIEGFMNNATPLYSYESHHLNESEFL
KPLYQ
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgttagattttgatttggttctttttggcgcgactggggatttagccatgcgaaagctc
tttgtttcgctctatgaaatttatactcattatggttttaaaaacgattctaggattatc
gcatcggggcgtaaggagctatccaatgaagaatttttaacactcctttgtgagaaaaca
caactgcattcaagagaaaagggtagggaatttttagcccatatcagttatttgtgcgtt
cgtttggataaccctaaagactttgaagaattgagtaaaatcgctacaaaaaataaaccc
ttgattttctacttttctatctcgcctagtttttttgcaacgaccgcccaacatttggcc
aaaaacgcgctcaatcacgccaacacacgcttgattttagaaaagcctttagggcatgat
ttaaagacatgtaaagagattttccaaagcattagcgttttttttaaagaagaacaaatc
tttagaatcgatcattatttagggaaaaagggcgttcaaaatatccttgaattgcgcctg
aataaccctattttaaatattttatgggatcaaatcagcgcagttgaaatctgcgtgtat
gagactttgggggtggaagaaagaggcgaattttacgataaaatcggggctttaagggat
atggttcaaaaccatctcttgcaagttttatcccttatcgctacagatttacccaacaat
ttaaaggatttgaggaaagaaaaaatcaaagttttaaaaaccttacaaccccctaaagat
tttaaaaaacaggttattcgggcccaatatcaaggctatagagatgaaaataaggtccat
aaagagagccagacagagacttttgttgctattaaagcctttttggatacgcccaaattt
aaaggcgtgcctttctaccttaagcacgctaaaaaaatgccccacaaccaagcgagcgtg
aaaatccattttaacgcggtcaatacgctagaatttttcctctctcaagataaaatcacc
ctcaccctaaaagatcatcaaaacccccttattttagaaacccataacaaacaagaattt
ttacggccctacgctaaattgctctatgatgcgatacaaaataaccacaataatttcgcc
caccagttggaattagaagcgtcatgggtttttattgacacgctcatagagggttttatg
aataacgccacgcccttatattcctatgaaagccaccatctaaacgaatcagaattttta
aaaccactctatcaataa

DBGET integrated database retrieval system