KEGG   Helicobacter pylori Rif2: C730_05720Help
Entry
C730_05720        CDS       T02318                                 

Gene name
porD
Definition
(GenBank) pyruvate flavodoxin oxidoreductase subunit delta
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
hei  Helicobacter pylori Rif2
Pathway
hei00010  Glycolysis / Gluconeogenesis
hei00020  Citrate cycle (TCA cycle)
hei00620  Pyruvate metabolism
hei00640  Propanoate metabolism
hei00650  Butanoate metabolism
hei00680  Methane metabolism
hei01100  Metabolic pathways
hei01120  Microbial metabolism in diverse environments
hei01130  Biosynthesis of antibiotics
hei01200  Carbon metabolism
Module
hei_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hei00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C730_05720 (porD)
   00020 Citrate cycle (TCA cycle)
    C730_05720 (porD)
   00620 Pyruvate metabolism
    C730_05720 (porD)
   00640 Propanoate metabolism
    C730_05720 (porD)
   00650 Butanoate metabolism
    C730_05720 (porD)
  Energy metabolism
   00680 Methane metabolism
    C730_05720 (porD)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    C730_05720 (porD)
Enzymes [BR:hei01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     C730_05720 (porD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_6 Fer4_10 Fer4_2 Fer4_7 Fer4_9 Fer4_17 Fer4_16 Fer4_15 Fer4_13 Fer4_8 Fer4_4 Fer4_22 Fer4_3
Motif
Other DBs
NCBI-ProteinID: AFV45507
Position
1170730..1171122
Genome map
AA seq 130 aa AA seqDB search
MKDWNEFEMGAVLFPFEKNAQSEMEKHNDERHYTEQSYFTTSVAHWRVAKPVHNNNICIN
CFNCWVYCPDAAILSREGKLKGVDYSHCKGCGVCVDVCPTNPKSLWMFEEQIEPATALTQ
WPQKQEKKKS
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgaaagattggaacgaatttgaaatgggagcggtgctcttcccttttgaaaaaaacgcg
caaagcgaaatggaaaaacacaatgatgagcgccattacaccgagcaaagttacttcacc
acttcagtggctcattggcgcgtggctaagcctgtgcataacaataatatttgtatcaat
tgctttaattgttgggtttattgcccagacgctgctattctttcaagagagggtaagtta
aagggcgtggattattctcattgtaaaggctgtggcgtgtgcgtggatgtctgccccacc
aaccctaaatcgctatggatgtttgaagaacaaattgagcctgctaccgctctcactcaa
tggccgcaaaaacaagaaaagaaaaaatcataa

DBGET integrated database retrieval system