KEGG   Halomonas elongata: HELO_1062Help
Entry
HELO_1062         CDS       T01311                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
hel  Halomonas elongata
Pathway
hel00240  Pyrimidine metabolism
hel00250  Alanine, aspartate and glutamate metabolism
hel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hel00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    HELO_1062 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HELO_1062 (pyrB)
Enzymes [BR:hel01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     HELO_1062 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: CBV40945
UniProt: E1V4A8
Position
complement(70574..71602)
Genome map
AA seq 342 aa AA seqDB search
MSSHLLSVDSLSRDDVDHLIRVAARMEPVAQRRKVTRVLEGAVLGNLFFEASTRTRVSFH
AAFCRLGGSVCDTTGFTFSSMAKGESLYDTSRVMSGYCDAIVMRHPEQGSVAEFAQATNV
PVINGGDGPGEHPSQALLDIYTIDKEFALRGKQLAGAHILLTGDLKFGRTVHSLIKLLSL
YAPMRITLVSPPGLEMPQHLVELVASRGHRVETRENLAGDFSDVDVVYTTRIQKERFTAE
MSEGFSLSRDYTVDKAFMDQRVNDHAIVMHPLPRDSRPDANDLDVDLNGDPRLAIFRQTD
NGIPMRMAIFATLLQVEDLVEKDMRDVPWFVPKTVGVDDVER
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgagctcccatctgctttccgttgattccctgtcacgcgatgatgtggatcacctgatt
cgtgtcgccgcccgtatggaaccggtcgcccagcggcgcaaggtcacaagagtgttggaa
ggtgcggtcctcggcaatctgttcttcgaagccagcacccgcactcgagtcagcttccac
gcggccttctgtcggctgggcggcagcgtctgcgacactaccggcttcaccttctcctcc
atggccaagggcgagtcgctctacgacaccagccgggtgatgagcggctactgcgacgcc
atcgtgatgcgccacccggagcagggctcggtggccgaattcgcccaggccaccaatgtg
ccggtgatcaacggcggcgacggtcccggcgagcaccccagtcaggcgctgctcgacatc
tacaccatcgacaaggaattcgccctgcgcggcaagcagctggctggtgcccatatcctg
ctcaccggtgacctcaagttcggccgcaccgtgcattcgctgatcaagctgctgtcgctc
tacgcgccgatgcggatcacgctggtttcgccgccggggctggaaatgccacagcacctg
gtcgagctggtcgcctcccgcggccaccgcgtcgagacccgcgagaacctggccggcgac
ttctcggacgtcgacgtggtctataccacccgcatccagaaggagcgtttcaccgccgaa
atgagcgagggcttcagcctctcgcgggactacaccgtggacaaggccttcatggatcag
cgagtcaacgaccacgccatcgtcatgcacccgctgccgcgcgacagtcgccccgacgcc
aacgacctggacgtggacctcaatggcgacccgcgcctggcgatcttccgccagaccgac
aacggtatccccatgcgcatggcgatcttcgcgaccctgctccaggtcgaagacctggtc
gagaaggacatgcgtgacgtgccctggttcgtgccgaagaccgtcggcgtggacgacgtc
gagcgctga

DBGET integrated database retrieval system