KEGG   Halomonas elongata: HELO_1083Help
Entry
HELO_1083         CDS       T01311                                 

Gene name
ispA
Definition
(GenBank) farnesyl diphosphate synthase
  KO
K13789  geranylgeranyl diphosphate synthase, type II [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
hel  Halomonas elongata
Pathway
hel00900  Terpenoid backbone biosynthesis
hel01100  Metabolic pathways
hel01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hel00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HELO_1083 (ispA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:hel01006]
    HELO_1083 (ispA)
Enzymes [BR:hel01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     HELO_1083 (ispA)
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     HELO_1083 (ispA)
    2.5.1.29  geranylgeranyl diphosphate synthase
     HELO_1083 (ispA)
Prenyltransferases [BR:hel01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   HELO_1083 (ispA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: CBV40966
UniProt: E1V4C9
Position
96304..97182
Genome map
AA seq 292 aa AA seqDB search
MNIERLMAADRRRVDECLETLFARGESAPSEQLDAAMRHGVLVGGKRLRPVLLYATGRAL
GASDEALDGPAMAVELVHAYSLVHDDLPAMDDDDVRRGRPTVHRAYDEATAILAGDALQT
LAFEVLADTGHPRLAAMVGTLARAAGRDGMAAGQALDLDAVGGHPDLTALATMHRHKTGA
LIHAAVRLGGLVAVPEDDERLLALERYAAAIGLAFQIRDDVLDVTGDTAVLGKTSGADAA
RDKPTYPTLLGLKGADDKARSLVDEAVSALAPLGEAGSVLANLARYMIERDH
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
gtgaatattgaacgcttgatggccgcggatcgtcgccgcgtggacgaatgcctggaaacg
ctcttcgcgcgcggcgagtcggcgccttcggagcagctggacgcggccatgcgtcatggc
gtgctggtcggtggcaagcgcttgcggccggtgctgctctatgccacggggcgcgccctg
ggcgcgagcgacgaagcgctcgacggtccggcgatggcggtcgagctggtgcatgcctat
tccctggtgcacgacgacctgccggccatggatgacgatgacgtgcgccgtggccggccc
accgtgcatcgcgcttatgacgaggccaccgccatcctggccggcgatgcgctgcagacc
cttgccttcgaagtgctggccgataccggccacccgcgcctggcggcgatggtcggcacc
ctggcccgagctgccgggcgtgacggcatggcggccggccaggcgctggatctggatgcc
gtggggggccaccccgacctgacggcgctggcgacgatgcatcgccacaagactggtgcg
ctgatccacgccgccgtgcgcctgggaggcctggtggcggtgcccgaggacgatgaacgc
ctgctggcgctggagcgttacgccgccgccatcgggctggcgttccagattcgcgatgac
gtgctcgacgtgaccggcgacacggccgtcctcggcaagacctcaggggcggacgccgcc
cgtgacaaaccgacctatcccaccctgctggggctgaagggggccgatgacaaggcccga
tccctggtggacgaggccgtatcggccctggcgccgctgggcgaggccggcagcgtgctg
gccaacctggcccgatacatgatcgagcgtgaccactga

DBGET integrated database retrieval system