KEGG   Halomonas elongata: HELO_1409Help
Entry
HELO_1409         CDS       T01311                                 

Definition
(GenBank) peroxiredoxin
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
hel  Halomonas elongata
Pathway
hel00480  Glutathione metabolism
hel00590  Arachidonic acid metabolism
hel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hel00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    HELO_1409
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    HELO_1409
Enzymes [BR:hel01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     HELO_1409
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: CBV41292
UniProt: E1V6G3
Position
466902..467393
Genome map
AA seq 163 aa AA seqDB search
MSIHDHDCRTHGGEPFNLRALRGQVLLIVNVASRCGFTSQLGELERLYRRHRDRGFTILA
FPCNQFGRQSPESAAGFCSFGEQTYSVTFPLMEKVRVNGRHAHPLFVELKREAPGVLGTK
AIKWNFTKFLVARDGRVVRRFPPRAGIRELNEALESILDEPWG
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgagcatccatgaccacgattgccgcacccatggcggcgagcccttcaacctccgcgcc
ctgcgcggccaggtgctcctgatcgtcaatgtggccagccgctgtggcttcacgtcccag
ctcggcgaactcgagcgtctctatcggcgtcaccgcgaccgcggcttcaccatactggcg
ttcccctgcaatcagttcggacggcaatctcccgagtcggcggccggattctgctcgttt
ggtgaacagacctatagcgtgacctttccgctgatggaaaaggtgcgggtcaacgggcgc
cacgctcatcccttgttcgtcgagctcaagcgcgaggcgccgggagtcctggggacgaag
gccatcaagtggaatttcaccaagttcctggtggcccgggatggccgcgtcgtgcgtcgc
ttcccgccacgggcggggatcagggagctcaacgaggcgctggagtccattctggacgaa
ccctgggggtga

DBGET integrated database retrieval system