KEGG   Halomonas elongata: HELO_1501Help
Entry
HELO_1501         CDS       T01311                                 

Definition
(GenBank) malonyl-CoA decarboxylase
  KO
K01578  malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
hel  Halomonas elongata
Pathway
hel00410  beta-Alanine metabolism
hel00640  Propanoate metabolism
hel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hel00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    HELO_1501
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    HELO_1501
Enzymes [BR:hel01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     HELO_1501
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCD MCD_N DUF3459
Motif
Other DBs
NCBI-ProteinID: CBV41384
UniProt: E1V734
Position
complement(574571..575926)
Genome map
AA seq 451 aa AA seqDB search
MNMTFLQEMFNNITQRDALLRRRHGYNTNPDHADLVGACRALLESDGEASSIALASRALA
MYERLDGSERRRFFARLAEEFAADPTRIDQAYAAYSESRDNATLNGLFEACEPRRQELFR
RLNLASDGTYQLVRMREDLLALRREHPELAGIDADFAHLFASWFNRGFLMLKRIDWNTPA
SLLERIIHYEAVHEIHDWNDLRRRLDTRDRRCFAFFHPAIGDEPLIFVEVALCKGLPDHI
QPILAGEDSDVEAPEDADTAAFFGISNCQTGLRGISFGNFLIKQVVQELKQELPQLKHFV
TLSPVPGFAQWLKAQRDDDSTSEAQREALAALDEPGWHRDPERAEALKAVVRPMAARYLT
QEKNDRGLPLNPVARFHLGNGAELHRINWLGDISDKGLEQAAGLMVNYLYVLNDIERNHE
NYTANATVACSSEVRDLARKARKQQAKGELK
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgaccttcctgcaggagatgttcaacaacatcacccagcgcgacgccttgctg
cgacgtcgccacgggtacaacaccaaccccgaccacgccgatctggtgggcgcctgccgc
gccctgctggagagcgatggcgaggcctcgagcatcgccctggccagccgcgccctggcc
atgtacgagcggctggatggcagcgaacgccggcgtttcttcgcccggctcgccgaggaa
ttcgccgccgatccgacgcgaatcgaccaggcctacgccgcctatagcgagtctcgcgac
aacgccaccctgaacggcctgttcgaggcctgcgaaccacggcgccaggagctgttccgg
cgactcaacctcgccagcgacggcacctatcaactggtccgcatgcgcgaggacctgctc
gccctgcgtcgcgaacacccagagctggcgggcatcgatgccgacttcgcccacctcttc
gcctcctggttcaatcgcggcttcctgatgctcaagcgcatcgactggaacacaccggcc
tcgctgctcgaacgcatcatccactacgaggcggtacacgaaatccacgactggaacgac
ctgcgccggcggctcgatacccgcgaccggcgctgtttcgccttcttccaccccgccatc
ggcgatgaaccgctgatcttcgtcgaagtggcgctgtgcaagggcttgccggatcacatc
cagccgatcctggcgggggaagacagcgacgtggaagcacccgaggatgccgacaccgcc
gccttcttcggcatcagcaactgccagaccgggctgcgcggcatttccttcggcaacttc
ctgatcaagcaggtggtgcaggaactcaagcaggaactgccccagctcaagcacttcgtc
accctttcgccggtgccgggcttcgctcaatggctgaaggcacagcgcgacgacgacagc
acgtccgaggcccagcgcgaggcgcttgcggccctcgatgagccgggctggcaccgggat
cccgaacgtgccgaggccctcaaggccgtcgtgcggccgatggccgcccgctatctgacg
caggagaagaacgaccggggattgccgctcaacccggtggcccgctttcacctcggcaac
ggcgccgagctgcatcgcatcaactggctcggcgacatctccgacaagggactcgagcag
gccgccggcctgatggtcaattacctctacgtgctcaacgacatcgaacgcaaccacgag
aactacaccgccaacgccaccgtggcctgctcgagtgaggttcgtgacctcgcccgcaag
gccaggaaacagcaggccaagggagagcttaaatga

DBGET integrated database retrieval system