KEGG   Halomonas elongata: HELO_2140Help
Entry
HELO_2140         CDS       T01311                                 

Gene name
thlA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hel  Halomonas elongata
Pathway
hel00071  Fatty acid degradation
hel00072  Synthesis and degradation of ketone bodies
hel00280  Valine, leucine and isoleucine degradation
hel00310  Lysine degradation
hel00362  Benzoate degradation
hel00380  Tryptophan metabolism
hel00620  Pyruvate metabolism
hel00630  Glyoxylate and dicarboxylate metabolism
hel00640  Propanoate metabolism
hel00650  Butanoate metabolism
hel00900  Terpenoid backbone biosynthesis
hel01100  Metabolic pathways
hel01110  Biosynthesis of secondary metabolites
hel01120  Microbial metabolism in diverse environments
hel01130  Biosynthesis of antibiotics
hel01200  Carbon metabolism
hel01212  Fatty acid metabolism
hel02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HELO_2140 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    HELO_2140 (thlA)
   00640 Propanoate metabolism
    HELO_2140 (thlA)
   00650 Butanoate metabolism
    HELO_2140 (thlA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HELO_2140 (thlA)
   00072 Synthesis and degradation of ketone bodies
    HELO_2140 (thlA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HELO_2140 (thlA)
   00310 Lysine degradation
    HELO_2140 (thlA)
   00380 Tryptophan metabolism
    HELO_2140 (thlA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HELO_2140 (thlA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HELO_2140 (thlA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HELO_2140 (thlA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hel04147]
    HELO_2140 (thlA)
Enzymes [BR:hel01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HELO_2140 (thlA)
Exosome [BR:hel04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HELO_2140 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CBV42024
UniProt: E1VAH8
Position
complement(1303234..1304421)
Genome map
AA seq 395 aa AA seqDB search
MSHADDIVFLSATRTPMGGMLGSLASLSAPQLAATAIRAAIERAGIEASAIDEGILGCVL
PAGVKQGPARQAMRQADIPDTIGATTINKLCGSGMKATMLAHDLIRAGSGEILLAGGMES
MSNAPHVLTRARTGYRLGHGELKDHMFLDGLEDAETGQLMGGFAQQIASERGYSRERLDD
FAIASLERAMQATEAGHLDAEMAPVTVKDRKGETRVEHDEQPFQARLDKIRELRPAFAKD
GTITAANSSSISDGASALILASQAAADRVGVKPIARMLGHSTHSRHPSEFTIAPVGAIDK
LMKKLDWGVDDVDLFEINEAFAVVTLMAMDDLSLPHDKVNVFGGACAQGHPIGSTGSRII
ATLIHALRTKGGKRGIASLCIGGGEATAVAVELID
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgagccacgccgacgatatcgtattcctctccgcgacccgcacgcccatgggcgggatg
ctcggcagcctcgcgtcgctcagcgcaccgcagctcgccgccaccgccattcgtgccgcc
atcgaacgcgccggcatcgaggcctccgccatcgacgagggcatcctgggctgtgtgctg
cccgccggcgtcaagcaagggccggcccggcaggccatgcgtcaggccgacattcccgac
accatcggcgccaccaccatcaacaagctgtgcggctcgggcatgaaggccaccatgctg
gcccatgacctgatccgcgccggcagtggcgagatcctgctcgccggcggcatggaatcc
atgtccaacgccccgcatgtgctgacccgggcgcgcaccggctaccgcctggggcacggc
gagttgaaggaccacatgttcctcgatggcctggaagacgccgagaccggtcagttgatg
ggcggcttcgcccagcagatcgccagcgagcgcggctattcccgcgagcggctcgatgac
ttcgccattgcctcgctggaacgcgccatgcaggccaccgaggccggccacctggatgcc
gagatggcgccggtcacggtcaaggatcgcaagggcgagacccgggtcgagcacgacgag
cagccctttcaggcccggctcgacaagattcgcgaactgcgcccggcgttcgccaaggac
ggcaccatcacggcggccaactcgagctcgatctccgacggcgcctcggcgctgatcctg
gccagccaggcggcggcggaccgggtcggcgtcaagcccatcgcccgcatgctgggccac
agcacccattcgcgccatccgagcgagttcaccatcgccccggtgggcgccatcgacaag
ctgatgaaaaaactcgattggggcgtcgacgacgtggacctgttcgagatcaacgaagcc
ttcgccgtggtcaccctgatggccatggacgacctgagcctgccccatgacaaggtcaac
gtcttcggcggtgcctgcgcccagggccaccccatcggctccaccggctcgcggatcatc
gccaccctgatccacgccctgcgcaccaagggcggcaagcgcggcatcgccagcctgtgc
atcggcggcggtgaagccaccgccgtggccgtggaactgatcgactga

DBGET integrated database retrieval system